BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0625 (677 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 27 0.54 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 27 0.72 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 25 2.2 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 27.1 bits (57), Expect = 0.54 Identities = 18/36 (50%), Positives = 23/36 (63%) Frame = -2 Query: 166 YVAIAQAVLPLYKNKNKTCNGRRKSI*LTSILKYGD 59 Y+ + QAVLPL KN N CN R+SI L I++ D Sbjct: 536 YIVLVQAVLPLDKNLN-DCN--RQSI-LGRIIRVTD 567 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 26.6 bits (56), Expect = 0.72 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 177 RGCCTSPLPRQCCH 136 +G C P PR+CCH Sbjct: 190 QGRCFGPKPRECCH 203 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 25.0 bits (52), Expect = 2.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 36 TRKCISLVSPYFNIDVSQIDLRRPLQVLFLFLYN 137 TR C+ + +D S + R +Q L ++LYN Sbjct: 133 TRLCLPQIFNNILMDFSVEQINRSIQELMIYLYN 166 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 612,221 Number of Sequences: 2352 Number of extensions: 11145 Number of successful extensions: 66 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68159265 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -