BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0624 (547 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10326| Best HMM Match : CBM_14 (HMM E-Value=5.3e-15) 33 0.20 SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 >SB_10326| Best HMM Match : CBM_14 (HMM E-Value=5.3e-15) Length = 134 Score = 32.7 bits (71), Expect = 0.20 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 137 CPVNPHIHWLLPHEGNCNLFYYCVWGRKVLRHC 235 C PH +L P +C +Y+C WG+ V + C Sbjct: 22 CADKPHGAYL-PDSTSCQHYYHCTWGKAVRKDC 53 >SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5222 Score = 27.5 bits (58), Expect = 7.6 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +2 Query: 122 FLENGCP-VNPHIHWLLPHEGNCNLFYYCVWGRKVLRHCP 238 F ++G P NP +W G C + +YC G + CP Sbjct: 2819 FCKSGSPDPNPDGYWPPVEAGPCKMGHYCPKGTQAPLPCP 2858 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,559,839 Number of Sequences: 59808 Number of extensions: 307620 Number of successful extensions: 528 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 504 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 527 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1252112599 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -