BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0616 (462 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) 96 1e-20 SB_31292| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0.0015) 39 0.002 SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) 39 0.002 SB_39367| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) 29 1.4 SB_32456| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_43115| Best HMM Match : SapB_1 (HMM E-Value=3.9) 29 1.9 SB_20812| Best HMM Match : rve (HMM E-Value=1.2e-25) 28 3.3 SB_50612| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) 28 4.3 SB_48736| Best HMM Match : RVT_1 (HMM E-Value=1.4e-11) 28 4.3 SB_45778| Best HMM Match : Exo_endo_phos (HMM E-Value=1e-10) 28 4.3 SB_29742| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) 28 4.3 SB_21418| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_10446| Best HMM Match : Exo_endo_phos (HMM E-Value=6.6e-20) 28 4.3 SB_8311| Best HMM Match : RVT_1 (HMM E-Value=3.9e-29) 28 4.3 SB_55599| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_45671| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_36722| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_26322| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_16967| Best HMM Match : Laminin_EGF (HMM E-Value=0) 28 4.3 SB_11339| Best HMM Match : TGF_beta (HMM E-Value=5.60519e-45) 27 5.7 SB_22316| Best HMM Match : fn3 (HMM E-Value=0.0034) 27 7.6 SB_43755| Best HMM Match : rve (HMM E-Value=5.6e-11) 27 7.6 SB_35820| Best HMM Match : TRAP_240kDa (HMM E-Value=0.006) 27 10.0 SB_58114| Best HMM Match : DUF1478 (HMM E-Value=3) 27 10.0 SB_12486| Best HMM Match : 7TMR-DISM_7TM (HMM E-Value=2.9) 27 10.0 SB_4186| Best HMM Match : ADK (HMM E-Value=0.094) 27 10.0 SB_106| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 10.0 >SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0) Length = 322 Score = 95.9 bits (228), Expect = 1e-20 Identities = 42/56 (75%), Positives = 52/56 (92%) Frame = +1 Query: 1 LQVNPKSIKSGDAAIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVIKAVN 168 L+ NPK IK+GDAA+V ++PSKP+CVE+F EFPPLGRFAVRDM+QTVAVGVIK+V+ Sbjct: 246 LEDNPKMIKTGDAAMVEMIPSKPMCVETFTEFPPLGRFAVRDMKQTVAVGVIKSVD 301 >SB_31292| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0.0015) Length = 80 Score = 39.1 bits (87), Expect = 0.002 Identities = 18/39 (46%), Positives = 26/39 (66%) Frame = +1 Query: 40 AIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVI 156 A V L S+P+CVE ++++ LGRF +R T+A GVI Sbjct: 40 AEVELQTSRPVCVELYKDYKDLGRFMLRYGGNTIAAGVI 78 >SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43) Length = 547 Score = 38.7 bits (86), Expect = 0.002 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +1 Query: 4 QVNPKSIKSGDAAIVNLVPSKPLCVESFQEFPPLGRFAVRD 126 Q P+ IK AI L +C+E F +F +GRF +RD Sbjct: 505 QTRPRFIKQDQIAIARLETQGVICIEKFSDFQQMGRFTLRD 545 >SB_39367| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) Length = 903 Score = 29.5 bits (63), Expect = 1.4 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +1 Query: 46 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 135 +++VP++P CV SF EF + +RD+ Q Sbjct: 380 MSVVPAQPQCVASFPEFCAVSVSYIRDLSQ 409 >SB_32456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 427 Score = 29.5 bits (63), Expect = 1.4 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 2/49 (4%) Frame = -2 Query: 404 FQIYYV*PYINYKIMLHYKPCKKYRKGMSL*PFFPSK-H-LSVNEVSQL 264 +QI+Y+ Y KI +H++ K RK + L FFPS H + +SQL Sbjct: 308 YQIFYILEYTG-KISIHWRYLKITRKYLLLLAFFPSALHPICYGNISQL 355 >SB_43115| Best HMM Match : SapB_1 (HMM E-Value=3.9) Length = 495 Score = 29.1 bits (62), Expect = 1.9 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -2 Query: 167 LTALMTPTATVCLMSRTAKRPRGGNSWKDSTHR 69 LT+L PT L RT +PR G W+ + H+ Sbjct: 409 LTSLNEPTGEDLLFGRTLWKPRFGYLWQSAIHQ 441 >SB_20812| Best HMM Match : rve (HMM E-Value=1.2e-25) Length = 1097 Score = 28.3 bits (60), Expect = 3.3 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -2 Query: 152 TPTATVCLMSRTAKRPRGGNSWKDSTHRGLEG 57 TP+ VCL+SR + PR W R + G Sbjct: 282 TPSLYVCLLSRAHRDPRLSTGWSPYEKREVRG 313 >SB_50612| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) Length = 904 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +1 Query: 46 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 135 ++++P++P CV SF EF + +RD+ Q Sbjct: 381 MSVMPAQPQCVASFPEFCAVSVSYIRDLLQ 410 >SB_48736| Best HMM Match : RVT_1 (HMM E-Value=1.4e-11) Length = 1175 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 46 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 135 +++ P++P CV SF EF + +RD+ Q Sbjct: 385 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 414 >SB_45778| Best HMM Match : Exo_endo_phos (HMM E-Value=1e-10) Length = 549 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 46 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 135 +++ P++P CV SF EF + +RD+ Q Sbjct: 389 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 418 >SB_29742| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) Length = 1131 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 46 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 135 +++ P++P CV SF EF + +RD+ Q Sbjct: 1044 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 1073 >SB_21418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 887 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 46 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 135 +++ P++P CV SF EF + +RD+ Q Sbjct: 532 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 561 >SB_10446| Best HMM Match : Exo_endo_phos (HMM E-Value=6.6e-20) Length = 1285 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 46 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 135 +++ P++P CV SF EF + +RD+ Q Sbjct: 1111 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 1140 >SB_8311| Best HMM Match : RVT_1 (HMM E-Value=3.9e-29) Length = 605 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 46 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 135 +++ P++P CV SF EF + +RD+ Q Sbjct: 184 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 213 >SB_55599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 988 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 46 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 135 +++ P++P CV SF EF + +RD+ Q Sbjct: 3 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 32 >SB_45671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 270 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 46 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 135 +++ P++P CV SF EF + +RD+ Q Sbjct: 87 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 116 >SB_36722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 46 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 135 +++ P++P CV SF EF + +RD+ Q Sbjct: 3 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 32 >SB_26322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 46 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 135 +++ P++P CV SF EF + +RD+ Q Sbjct: 3 MSVTPAQPQCVASFPEFSAVSVSYIRDILQ 32 >SB_16967| Best HMM Match : Laminin_EGF (HMM E-Value=0) Length = 1706 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 201 SCRKGHQGQEVARAVNSTFFIQLRYFIH 284 +CRKG +G +A+ TF+ L Y +H Sbjct: 522 TCRKGVEGFSCKQALYGTFYPALDYLLH 549 >SB_11339| Best HMM Match : TGF_beta (HMM E-Value=5.60519e-45) Length = 481 Score = 27.5 bits (58), Expect = 5.7 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = -2 Query: 380 YINYKIMLHYKPCKKYRKGMSL*PFFPSKHLSVNEVSQLYEKCAVNSSSY 231 Y NYK M+ + C+K K L P S ++V++ +C +NSS+Y Sbjct: 338 YKNYKDMVVERSCEKAAKTSCLISIEP---FSNHDVNRGRVRCTLNSSNY 384 >SB_22316| Best HMM Match : fn3 (HMM E-Value=0.0034) Length = 3404 Score = 27.1 bits (57), Expect = 7.6 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +3 Query: 57 TFQASMCRVLPGIPTPRSFCCP*HEADS 140 T + R LPGI P CC H DS Sbjct: 2446 TEETEEMRTLPGIANPEGPCCVNHTMDS 2473 >SB_43755| Best HMM Match : rve (HMM E-Value=5.6e-11) Length = 461 Score = 27.1 bits (57), Expect = 7.6 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 293 VSKEKRATNSFLFYIFYKACNVTLFYNLYKVIHNISE 403 V K+KR SFL Y V +F ++ +V+H ++E Sbjct: 18 VPKKKRELQSFLGLCTYYRKYVKMFADIARVLHRLTE 54 >SB_35820| Best HMM Match : TRAP_240kDa (HMM E-Value=0.006) Length = 1382 Score = 26.6 bits (56), Expect = 10.0 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +3 Query: 33 RCSHCQLGTFQASMCRVLPGIPTPRS 110 R ++ +F++SM +VLP PTPR+ Sbjct: 716 RLEQQRVTSFESSMHKVLPSPPTPRN 741 >SB_58114| Best HMM Match : DUF1478 (HMM E-Value=3) Length = 231 Score = 26.6 bits (56), Expect = 10.0 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 46 VNLVPSKPLCVESFQEFPPLGRFAVRDMRQ 135 +++ P++P CV SF EF + +RD+ Q Sbjct: 3 MSVTPAQPQCVASFPEFFAVSVSYIRDILQ 32 >SB_12486| Best HMM Match : 7TMR-DISM_7TM (HMM E-Value=2.9) Length = 492 Score = 26.6 bits (56), Expect = 10.0 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -3 Query: 442 YEFTL*FAVITKCFRYI 392 Y + + FA+IT+CFRY+ Sbjct: 34 YVYPVFFAMITRCFRYV 50 >SB_4186| Best HMM Match : ADK (HMM E-Value=0.094) Length = 1053 Score = 26.6 bits (56), Expect = 10.0 Identities = 16/48 (33%), Positives = 20/48 (41%) Frame = -2 Query: 230 FLPLVAFSAALVTLPPPASLKLTALMTPTATVCLMSRTAKRPRGGNSW 87 F P V +L P AS + A M VC +S T GGN + Sbjct: 540 FAPKVTLPYSLPFFTPGASGTIEAKMIARKVVCKLSITVLMAYGGNDY 587 >SB_106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 26.6 bits (56), Expect = 10.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 374 NYKIMLHYKPCKKYRKGMSL*PF 306 +YK L KPCK +R+G PF Sbjct: 253 DYKSALGAKPCKYFREGKGTCPF 275 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,564,566 Number of Sequences: 59808 Number of extensions: 246840 Number of successful extensions: 747 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 685 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 747 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 945255773 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -