BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0616 (462 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical prot... 24 3.0 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 24 3.0 AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1... 23 3.9 AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1... 23 3.9 AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1... 23 3.9 AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant r... 23 3.9 AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 pr... 23 5.2 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 23 5.2 AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 23 6.9 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 23 6.9 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 23 6.9 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 23 6.9 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 23 6.9 AY045760-1|AAK84942.1| 165|Anopheles gambiae D7-related 1 prote... 23 6.9 AJ133852-1|CAB39727.1| 165|Anopheles gambiae D7-related 1 prote... 23 6.9 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 23 6.9 >AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical protein protein. Length = 257 Score = 23.8 bits (49), Expect = 3.0 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 257 KCAVNSSSYFLPLVAFSAALVTLPPP 180 KC+ N S F P V + +PPP Sbjct: 45 KCSRNGSPKFAPAVQSKNRMPPVPPP 70 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.8 bits (49), Expect = 3.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 29 LEMQPLSTWYLPSLYV*SP 85 LE PL++W LP YV P Sbjct: 632 LEPVPLASWQLPPPYVTEP 650 >AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 23.4 bits (48), Expect = 3.9 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = +2 Query: 299 KEKRATNSFLFYIFYKACNVTLFYNLYKVIHNISETFCYDCKLKC 433 K+ + N +F VTL Y L K +NI+ KL C Sbjct: 35 KDVKDINDIANALFVLMTQVTLIYKLEKFNYNIARIQACLRKLNC 79 >AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 23.4 bits (48), Expect = 3.9 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = +2 Query: 299 KEKRATNSFLFYIFYKACNVTLFYNLYKVIHNISETFCYDCKLKC 433 K+ + N +F VTL Y L K +NI+ KL C Sbjct: 35 KDVKDINDIANALFVLMTQVTLIYKLEKFNYNIARIQACLRKLNC 79 >AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 23.4 bits (48), Expect = 3.9 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = +2 Query: 299 KEKRATNSFLFYIFYKACNVTLFYNLYKVIHNISETFCYDCKLKC 433 K+ + N +F VTL Y L K +NI+ KL C Sbjct: 35 KDVKDINDIANALFVLMTQVTLIYKLEKFNYNIARIQACLRKLNC 79 >AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant receptor Or1 protein. Length = 417 Score = 23.4 bits (48), Expect = 3.9 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = +2 Query: 299 KEKRATNSFLFYIFYKACNVTLFYNLYKVIHNISETFCYDCKLKC 433 K+ + N +F VTL Y L K +NI+ KL C Sbjct: 69 KDVKDINDIANALFVLMTQVTLIYKLEKFNYNIARIQACLRKLNC 113 >AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 23.0 bits (47), Expect = 5.2 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +2 Query: 311 ATNSFLFYIFYKACNVTLFYNLYKV 385 A FLF Y+ +T FY LY++ Sbjct: 291 AAQVFLFVAAYETNAITTFYCLYEL 315 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 23.0 bits (47), Expect = 5.2 Identities = 10/29 (34%), Positives = 12/29 (41%) Frame = -2 Query: 173 LKLTALMTPTATVCLMSRTAKRPRGGNSW 87 L L + A VCLM PR +W Sbjct: 17 LALNTMRVERADVCLMVELHSVPRNNGNW 45 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 22.6 bits (46), Expect = 6.9 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = -2 Query: 215 AFSAALVTLPPPASLKLTALMTPTATVCLMSRTAKRP 105 A S V PP S TA T T T + K P Sbjct: 559 ATSPPAVATPPSTSRARTATRTATTTTRALRSAKKEP 595 Score = 22.2 bits (45), Expect = 9.1 Identities = 9/36 (25%), Positives = 18/36 (50%) Frame = +3 Query: 219 QGQEVARAVNSTFFIQLRYFIHRKVFRRKKGLQTHS 326 +G+ ++ ST+ + K+F + L+THS Sbjct: 115 RGKRTQQSTGSTYMCNYCNYTSNKLFLLSRHLKTHS 150 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 22.6 bits (46), Expect = 6.9 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = -2 Query: 188 PPPASLKLTALMTPTATVCLMSRTAKRPRGGNSWKD 81 PPP + T + PTAT T P +W D Sbjct: 212 PPPPTTTTTVWIDPTATT-----TTHAPTTTTTWSD 242 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = -2 Query: 188 PPPASLKLTALMTPTATVCLMSRTAKRPRGGNSWKD 81 PPP + T PTAT T P +W D Sbjct: 179 PPPTTTTTTVWTDPTATT-----TTPAPTTTTTWSD 209 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 22.6 bits (46), Expect = 6.9 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = -2 Query: 188 PPPASLKLTALMTPTATVCLMSRTAKRPRGGNSWKD 81 PPP + T + PTAT T P +W D Sbjct: 212 PPPPTTTTTVWIDPTATT-----TTHAPTTTTTWSD 242 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = -2 Query: 188 PPPASLKLTALMTPTATVCLMSRTAKRPRGGNSWKD 81 PPP + T PTAT T P +W D Sbjct: 179 PPPTTTTTTVWTDPTATT-----TTPAPTTTTTWSD 209 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 22.6 bits (46), Expect = 6.9 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = -2 Query: 188 PPPASLKLTALMTPTATVCLMSRTAKRPRGGNSWKD 81 PPP + T + PTAT T P +W D Sbjct: 212 PPPPTTTTTVWIDPTATT-----TTHAPTTTTTWSD 242 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 22.6 bits (46), Expect = 6.9 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = -2 Query: 188 PPPASLKLTALMTPTATVCLMSRTAKRPRGGNSWKD 81 PPP + T + PTAT T P +W D Sbjct: 211 PPPPTTTTTVWIDPTATT-----TTHAPTTTTTWSD 241 >AY045760-1|AAK84942.1| 165|Anopheles gambiae D7-related 1 protein protein. Length = 165 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 299 SKHLSVNEVSQLYEKCAVNSSS 234 ++HL V + + Y KC V S+S Sbjct: 102 TQHLPVGKRANAYYKCLVESTS 123 >AJ133852-1|CAB39727.1| 165|Anopheles gambiae D7-related 1 protein protein. Length = 165 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 299 SKHLSVNEVSQLYEKCAVNSSS 234 ++HL V + + Y KC V S+S Sbjct: 102 TQHLPVGKRANAYYKCLVESTS 123 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 22.6 bits (46), Expect = 6.9 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = -2 Query: 188 PPPASLKLTALMTPTATVCLMSRTAKRPRGGNSWKD 81 PPP + T + PTAT T P +W D Sbjct: 212 PPPPTTTTTVWIDPTATT-----TTHAPTTTTTWSD 242 Score = 22.2 bits (45), Expect = 9.1 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = -2 Query: 188 PPPASLKLTALMTPTATVCLMSRTAKRPRGGNSWKD 81 PPP + T PTAT T P +W D Sbjct: 179 PPPTTTTTTVWTDPTATT-----TTHAPTTTTTWSD 209 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 459,035 Number of Sequences: 2352 Number of extensions: 9149 Number of successful extensions: 53 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39969834 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -