BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0612 (660 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 22 3.9 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 22 3.9 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 22 3.9 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 22 3.9 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 22 3.9 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 9.0 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 9.0 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 9.0 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 9.0 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 9.0 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 22.2 bits (45), Expect = 3.9 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -2 Query: 122 VDPPDPGGGYILDPSNSPIPMDTESVHPSRKRQTPP 15 VD D G L PS++ + + +HPS R P Sbjct: 44 VDDDDTDGRESLSPSSAHTVLIPQPLHPSVPRLGHP 79 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 22.2 bits (45), Expect = 3.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 293 LSDRSKCFGYLYNLGCFI 240 LSDR K F L+NL F+ Sbjct: 177 LSDRYKVFVDLFNLSTFL 194 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 22.2 bits (45), Expect = 3.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 293 LSDRSKCFGYLYNLGCFI 240 LSDR K F L+NL F+ Sbjct: 337 LSDRYKVFVDLFNLSTFL 354 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 22.2 bits (45), Expect = 3.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 293 LSDRSKCFGYLYNLGCFI 240 LSDR K F L+NL F+ Sbjct: 337 LSDRYKVFVDLFNLSTFL 354 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 22.2 bits (45), Expect = 3.9 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 136 TLFTLNYYIIILTNKTTHLYKHKT 207 +L+ NYY+I++T YK +T Sbjct: 74 SLYCFNYYVIVVTT----FYKRRT 93 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.0 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 427 FFFFYRLCIEIVGKLFH 477 FFF L I+ V LFH Sbjct: 1332 FFFALILVIQFVAMLFH 1348 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.0 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 427 FFFFYRLCIEIVGKLFH 477 FFF L I+ V LFH Sbjct: 1332 FFFALILVIQFVAMLFH 1348 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.0 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 427 FFFFYRLCIEIVGKLFH 477 FFF L I+ V LFH Sbjct: 1332 FFFALILVIQFVAMLFH 1348 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.0 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 427 FFFFYRLCIEIVGKLFH 477 FFF L I+ V LFH Sbjct: 1332 FFFALILVIQFVAMLFH 1348 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.0 bits (42), Expect = 9.0 Identities = 6/18 (33%), Positives = 13/18 (72%) Frame = -2 Query: 281 SKCFGYLYNLGCFIGFHS 228 ++ FG++ +GC I F++ Sbjct: 531 NRIFGFIIIIGCLIQFNT 548 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,426 Number of Sequences: 336 Number of extensions: 3317 Number of successful extensions: 13 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -