BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0612 (660 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g05160.1 68418.m00549 leucine-rich repeat transmembrane prote... 29 2.1 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 29 3.6 >At5g05160.1 68418.m00549 leucine-rich repeat transmembrane protein kinase, putative Length = 640 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = -2 Query: 101 GGYILDPSNSPIPMDTESVHPSRKRQT 21 GG I SN P P+ TE++HP R+RQ+ Sbjct: 238 GGAISPSSNLPRPL-TENLHPVRRRQS 263 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 28.7 bits (61), Expect = 3.6 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -2 Query: 104 GGGYILDPSNSPIPMDTESVH-PSRKRQTP-PNSDY 3 GG PS SP P+ T VH P +++P PN Y Sbjct: 387 GGSSQATPSKSPSPVPTRPVHKPQPPKESPQPNDPY 422 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,631,876 Number of Sequences: 28952 Number of extensions: 258712 Number of successful extensions: 566 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 550 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 566 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1383534864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -