BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0601 (593 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44680| Best HMM Match : Gemini_V1 (HMM E-Value=4) 93 2e-19 SB_18456| Best HMM Match : Syja_N (HMM E-Value=1.9e-12) 28 4.9 >SB_44680| Best HMM Match : Gemini_V1 (HMM E-Value=4) Length = 248 Score = 93.1 bits (221), Expect = 2e-19 Identities = 40/63 (63%), Positives = 48/63 (76%) Frame = +3 Query: 3 EPDARSLEKINATENAISAVAKIIKYNHSQINRDEIITHWLTWLPVTEDTEEAPHVYALL 182 +P +RS E INATENAISAV KI K+NH IN D++I WL+WLP+ ED EEA HVY L Sbjct: 38 DPQSRSRENINATENAISAVTKICKFNHGNINVDDVIPTWLSWLPIIEDKEEATHVYGYL 97 Query: 183 CEL 191 C+L Sbjct: 98 CDL 100 >SB_18456| Best HMM Match : Syja_N (HMM E-Value=1.9e-12) Length = 660 Score = 28.3 bits (60), Expect = 4.9 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +3 Query: 438 PCTLFWLLPLLINYCTLF*WHNMY 509 P W+LP++ YC++ HNM+ Sbjct: 349 PLASSWILPVIQGYCSIVHCHNMF 372 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,652,617 Number of Sequences: 59808 Number of extensions: 359483 Number of successful extensions: 897 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 896 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -