BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0599 (767 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC26H5.07c |||seven transmembrane receptor-like protein|Schizo... 25 9.0 SPCC1223.08c |dfr1||dihydrofolate reductase Dfr1|Schizosaccharom... 25 9.0 >SPAC26H5.07c |||seven transmembrane receptor-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 505 Score = 25.4 bits (53), Expect = 9.0 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +2 Query: 416 YACFGHFFFVGSTNTKRYTKKN*VVCKVC 502 + CF HFF V +++ K ++ + +VC Sbjct: 11 FICFLHFFIVNASDNKSLLTEDIMASQVC 39 >SPCC1223.08c |dfr1||dihydrofolate reductase Dfr1|Schizosaccharomyces pombe|chr 3|||Manual Length = 461 Score = 25.4 bits (53), Expect = 9.0 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = -3 Query: 351 CLYGWTSSQPTWC*EVTGAHRHLQRKCATHLKNLPL 244 CL+GW S P + ++ ++L + H P+ Sbjct: 9 CLHGWIQSGPVFSKKMGSVQKYLSKYAELHFPTGPV 44 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,914,897 Number of Sequences: 5004 Number of extensions: 55449 Number of successful extensions: 99 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 99 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 369323696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -