BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0597 (749 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) 171 4e-43 SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.43 SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) 32 0.43 SB_6196| Best HMM Match : rve (HMM E-Value=3.7e-12) 29 3.0 SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) 29 3.0 SB_20635| Best HMM Match : rve (HMM E-Value=0.91) 29 4.0 SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_52533| Best HMM Match : rve (HMM E-Value=2) 29 4.0 SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) 29 4.0 SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) 29 4.0 SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) 28 7.0 SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 28 7.0 SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) 28 7.0 SB_25441| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_8063| Best HMM Match : Homeobox (HMM E-Value=8.5e-24) 28 9.3 SB_6385| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.00099) 28 9.3 >SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 171 bits (417), Expect = 4e-43 Identities = 84/104 (80%), Positives = 92/104 (88%), Gaps = 2/104 (1%) Frame = +3 Query: 210 QTREHLLVF-FTNQRIEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNG 386 +T EH+ +F + EIIDFFLG +L DEVLKIMPVQKQTRAGQRTRFKAFVAIGD+NG Sbjct: 24 KTLEHIYLFSLPIKEFEIIDFFLGAALKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDSNG 83 Query: 387 HIGLGVKCSKEVATAIRGAIILAKLSVLPVRRGYWGNKIGN-HT 515 H+GLGVKCSKEVATAIRGAIILAKLSV+PVRRGYWGNKIG HT Sbjct: 84 HVGLGVKCSKEVATAIRGAIILAKLSVIPVRRGYWGNKIGKPHT 127 Score = 129 bits (312), Expect = 2e-30 Identities = 58/81 (71%), Positives = 61/81 (75%) Frame = +2 Query: 506 KPHTVPCKVTGKCGSVTVRLIPEPRGTGIVSAPVPKKLLQMAGVQDCYTSARGSTGTLGN 685 KPHTVPCKVTGKCGS VRLIP PRGTGIVSAPVPKKLLQMAG++DCYTS RG T TLGN Sbjct: 124 KPHTVPCKVTGKCGSTRVRLIPAPRGTGIVSAPVPKKLLQMAGIEDCYTSTRGQTATLGN 183 Query: 686 FXXXXXXXXXXXXXXLTPDLW 748 F LTPD+W Sbjct: 184 FAKATFAAISETYAYLTPDMW 204 Score = 54.0 bits (124), Expect = 1e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 160 WVPVTKLGRLVREGKIDKLESIYLFSLPIKE 252 WVPVTKLGRLV++ KI LE IYLFSLPIKE Sbjct: 8 WVPVTKLGRLVKDLKIKTLEHIYLFSLPIKE 38 >SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1049 Score = 32.3 bits (70), Expect = 0.43 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = -1 Query: 461 QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDLKNLIIQG 282 ++ + NS N D TNMT + + G CL + TC+ L DL NL+ + Sbjct: 235 RILRRNSQPNDQADVARLQSLITNMTEIYSTGKVCL-NITRNNTCMSL-DPDLGNLMSRS 292 Query: 281 RAEEEI 264 R ++E+ Sbjct: 293 RNQDEL 298 >SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) Length = 657 Score = 32.3 bits (70), Expect = 0.43 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = -1 Query: 461 QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDLKNLIIQG 282 ++ + NS N D TNMT + + G CL + TC+ L DL NL+ + Sbjct: 519 RILRRNSQPNDQADVARLQSLITNMTEIYSTGKVCL-NITRNNTCMSL-DPDLGNLMSRS 576 Query: 281 RAEEEI 264 R ++E+ Sbjct: 577 RNQDEL 582 >SB_6196| Best HMM Match : rve (HMM E-Value=3.7e-12) Length = 444 Score = 29.5 bits (63), Expect = 3.0 Identities = 20/57 (35%), Positives = 28/57 (49%) Frame = -1 Query: 704 RMWL*QNFPRCQLNHELTCSNPVHQPSEEAS*ELAQTQYQYHEVQESAGLLRNHTCR 534 ++W+ + C L E SN +A LA Q Q H VQE++G +R TCR Sbjct: 79 QVWVAEIVDECILGLEFLVSNNCSVNFVDACLCLAGEQVQLHGVQENSGEIR--TCR 133 >SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) Length = 280 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/44 (43%), Positives = 23/44 (52%) Frame = -1 Query: 434 NGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDL 303 N G LA + N+ +V NG K + C LS T L LY HDL Sbjct: 108 NAYGKSLAEFYNSNNL--IVLNGVK--QGCMLSPTLLNLYVHDL 147 >SB_20635| Best HMM Match : rve (HMM E-Value=0.91) Length = 748 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 288 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 401 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 155 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 192 >SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 945 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 288 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 401 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 811 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 848 >SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 288 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 401 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 2008 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 2045 >SB_52533| Best HMM Match : rve (HMM E-Value=2) Length = 212 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 288 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 401 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 95 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 132 >SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) Length = 212 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 288 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 401 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 9 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 46 >SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) Length = 735 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 288 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 401 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 532 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 569 >SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) Length = 1130 Score = 28.3 bits (60), Expect = 7.0 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 338 TAHTFQGICCHWRQQRSYW 394 TA + ICCH +Q + +W Sbjct: 486 TADQYDAICCHTQQSKKFW 504 >SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) Length = 897 Score = 28.3 bits (60), Expect = 7.0 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +3 Query: 336 GQRTRFKAFVAIGDNNGHIGLGVKCSKEVA 425 G++ + K F+A+G NGH+ C ++A Sbjct: 356 GRKDKRKDFLALGLRNGHVEFRFSCGADIA 385 >SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) Length = 453 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = -2 Query: 133 HDHGRDHYRVHEDRHGLYLHRVIRXRRENRHVH 35 H H R H+ H H + HR R + H H Sbjct: 312 HHHHRHHHHHHHHHHQRHRHRHRHRHRHHHHHH 344 >SB_25441| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 932 Score = 27.9 bits (59), Expect = 9.3 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +2 Query: 539 KCGSVTVRLIPEPRGTGIVSAPVPKKLLQMAGVQDCYTSARGSTGTLG 682 +CG+ + R ++ P+P L ++ +Q C + STGT G Sbjct: 591 RCGTHALTKTVSERVPDVLKHPLPPPLQELQELQVCDPPSTSSTGTTG 638 >SB_8063| Best HMM Match : Homeobox (HMM E-Value=8.5e-24) Length = 963 Score = 27.9 bits (59), Expect = 9.3 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = -2 Query: 463 DSLARIIAPRMAVATSLLHFTPKPI*PLLSPMATNALKRVRCPA 332 D+L+ IAP A SLL + P+++P A +AL ++ P+ Sbjct: 365 DALSLQIAPSANNALSLLKGAYDALSPMIAPSANDALSLLKAPS 408 >SB_6385| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.00099) Length = 437 Score = 27.9 bits (59), Expect = 9.3 Identities = 20/72 (27%), Positives = 35/72 (48%) Frame = +3 Query: 159 VGSCHQTRPSCSRRKNRQTREHLLVFFTNQRIEIIDFFLGPSLNDEVLKIMPVQKQTRAG 338 +G+ + P S+RK ++ + + T +RI GP D+ + + +K+TRAG Sbjct: 14 LGAHGEVGPCASKRKRKKVSKE--IDCTGKRISTT---FGPIEPDKRMATVASKKKTRAG 68 Query: 339 QRTRFKAFVAIG 374 R F+A G Sbjct: 69 HRAFVTRFMAEG 80 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,907,010 Number of Sequences: 59808 Number of extensions: 532589 Number of successful extensions: 1498 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1327 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1497 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -