BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0594 (743 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 26 0.32 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 26 0.32 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 23 3.0 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 22 5.3 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 26.2 bits (55), Expect = 0.32 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = +2 Query: 17 KNKQYFKRYQVKFKRRREGKTDYYARKRLVVQDKNKYNTPKY 142 KN++ +++Y+ K R +T+ K + N YN Y Sbjct: 273 KNEREYRKYRETSKGRSRDRTERERSKETKIISSNNYNYKNY 314 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 26.2 bits (55), Expect = 0.32 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = +2 Query: 17 KNKQYFKRYQVKFKRRREGKTDYYARKRLVVQDKNKYNTPKY 142 KN++ +++Y+ K R +T+ K + N YN Y Sbjct: 284 KNEREYRKYRETSKGRSRDRTERERSKETKIISSNNYNYKNY 325 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/39 (25%), Positives = 22/39 (56%) Frame = +2 Query: 77 TDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDVTCQVAY 193 TD RK ++ +++ K ++ ++V + N+D +AY Sbjct: 288 TDTLIRKYIIPKEQVKEDSLYTNIVVDIRNEDCGSAIAY 326 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 268 DQPSHITWQLM*ISSAHNMVTFN 200 ++PS+ TW+L +S H T N Sbjct: 7 NRPSYCTWELNATNSPHTCRTKN 29 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,217 Number of Sequences: 438 Number of extensions: 4255 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23266665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -