BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0593 (581 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05590.1 68416.m00621 60S ribosomal protein L18 (RPL18B) simi... 130 7e-31 At5g27850.1 68418.m03341 60S ribosomal protein L18 (RPL18C) 60S ... 128 2e-30 At2g47570.1 68415.m05936 60S ribosomal protein L18 (RPL18A) 121 4e-28 At2g02640.1 68415.m00203 DC1 domain-containing protein contain... 31 0.56 At1g18750.1 68414.m02338 MADS-box protein (AGL65) similar to hom... 29 1.7 At1g73730.1 68414.m08537 ethylene-insensitive3-like3 (EIL3) iden... 29 2.3 At3g28360.1 68416.m03544 ABC transporter family protein similar ... 29 3.0 At2g31760.1 68415.m03878 zinc finger protein-related contains lo... 28 4.0 At4g35730.1 68417.m05071 expressed protein contains Pfam profil... 28 5.2 At3g59820.1 68416.m06675 calcium-binding mitochondrial protein-r... 28 5.2 At1g05440.1 68414.m00552 expressed protein ; expression supporte... 28 5.2 At3g28415.1 68416.m03551 P-glycoprotein, putative contains ATP-b... 27 6.9 At3g28390.1 68416.m03547 P-glycoprotein, putative similar to P-g... 27 6.9 At1g32190.1 68414.m03959 expressed protein 27 6.9 At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pf... 27 9.1 >At3g05590.1 68416.m00621 60S ribosomal protein L18 (RPL18B) similar to GB:P42791 Length = 187 Score = 130 bits (314), Expect = 7e-31 Identities = 58/90 (64%), Positives = 74/90 (82%) Frame = +2 Query: 254 GTVTNDVRLYKIPKMTVAALHVTEKARARILAAGGEILTFDQLAIRAPTGKKTVLVQGQR 433 GT+T+D+R+++IP M V AL TE+ARARI AGGE LTFDQLA+RAP G+ TVL++G + Sbjct: 83 GTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPK 142 Query: 434 NAREAVRHFGPAPGAPRSHTKPYVRPRDMK 523 N+REAV+HFGPAPG P SH+KPYVR + K Sbjct: 143 NSREAVKHFGPAPGVPHSHSKPYVRAKGRK 172 Score = 61.7 bits (143), Expect = 3e-10 Identities = 35/85 (41%), Positives = 49/85 (57%), Gaps = 1/85 (1%) Frame = +3 Query: 6 MGID-INHKHDRKVRRTEVKSQDIXXXXXXXXXXXXXXXTNAKFNQIVLRRLFMSRINRP 182 MGID I +K +RT KS D+ TN+KFN ++L+RLFMS++N+ Sbjct: 1 MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTNSKFNGVILKRLFMSKVNKA 60 Query: 183 PISVSRLARHMKKPTREGLIAVVVG 257 P+S+SRL M +E IAV+VG Sbjct: 61 PLSLSRLVEFM--TGKEDKIAVLVG 83 >At5g27850.1 68418.m03341 60S ribosomal protein L18 (RPL18C) 60S ribosomal protein L18, Arabidopsis thaliana, SWISSPROT:RL18_ARATH Length = 187 Score = 128 bits (310), Expect = 2e-30 Identities = 58/90 (64%), Positives = 74/90 (82%) Frame = +2 Query: 254 GTVTNDVRLYKIPKMTVAALHVTEKARARILAAGGEILTFDQLAIRAPTGKKTVLVQGQR 433 GT+T+D+R+++IP M V AL TE+ARARI AGGE LTFDQLA+RAP G+ TVL++G + Sbjct: 83 GTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPK 142 Query: 434 NAREAVRHFGPAPGAPRSHTKPYVRPRDMK 523 N+REAV+HFGPAPG P S+TKPYVR + K Sbjct: 143 NSREAVKHFGPAPGVPHSNTKPYVRHKGRK 172 Score = 57.2 bits (132), Expect = 7e-09 Identities = 32/85 (37%), Positives = 48/85 (56%), Gaps = 1/85 (1%) Frame = +3 Query: 6 MGID-INHKHDRKVRRTEVKSQDIXXXXXXXXXXXXXXXTNAKFNQIVLRRLFMSRINRP 182 MGID I +K +RT KS D+ +N+ FN ++L+RLFMS++N+ Sbjct: 1 MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSNSNFNAVILKRLFMSKVNKA 60 Query: 183 PISVSRLARHMKKPTREGLIAVVVG 257 P+S+SRL M ++ IAV+VG Sbjct: 61 PLSLSRLVEFM--TGKDDKIAVLVG 83 >At2g47570.1 68415.m05936 60S ribosomal protein L18 (RPL18A) Length = 135 Score = 121 bits (291), Expect = 4e-28 Identities = 58/91 (63%), Positives = 68/91 (74%), Gaps = 1/91 (1%) Frame = +2 Query: 254 GTVTNDVRLYKIPKMTVAALHVTEKARARILAAGGEILTFDQLAIRAPT-GKKTVLVQGQ 430 GTVT+DVR+ +P +TV AL TE ARARI AGGE LTFDQLA+ PT + TVL++G Sbjct: 30 GTVTDDVRIEDVPALTVTALRFTESARARIHKAGGECLTFDQLALPCPTWSENTVLLRGP 89 Query: 431 RNAREAVRHFGPAPGAPRSHTKPYVRPRDMK 523 +N REAV+HFGPAPG P SHTKPYVR K Sbjct: 90 KNTREAVKHFGPAPGVPHSHTKPYVRQTGKK 120 Score = 35.1 bits (77), Expect = 0.034 Identities = 16/32 (50%), Positives = 25/32 (78%) Frame = +3 Query: 162 MSRINRPPISVSRLARHMKKPTREGLIAVVVG 257 MS++N+ P+S+SRL R+M ++G IAV+VG Sbjct: 1 MSKVNKAPLSLSRLVRYM--DGKDGKIAVIVG 30 >At2g02640.1 68415.m00203 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 627 Score = 31.1 bits (67), Expect = 0.56 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 307 CSSCYRKSSCTHFGCWRRNSYF 372 CS+C RKS+ + C+ RN YF Sbjct: 423 CSACMRKSNGFGYSCYNRNCYF 444 >At1g18750.1 68414.m02338 MADS-box protein (AGL65) similar to homeodomain transcription factor (AGL30) GI:3461830 from [Arabidopsis thaliana]; contains Pfam domain PF00319: SRF-type transcription factor (DNA-binding and dimerisation domain); PMID: 12837945 Length = 389 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -1 Query: 464 GQSDALPHEHFADLVPVLSSCQSEHE*PADQ 372 G S LPH +PV SSC E P DQ Sbjct: 223 GDSSFLPHREMDGSIPVYSSCFFESTKPEDQ 253 >At1g73730.1 68414.m08537 ethylene-insensitive3-like3 (EIL3) identical to ethylene-insensitive3-like3 (EIL3) GB:AF004215 [Arabidopsis thaliana] (Cell 89 (7), 1133-1144 (1997)) Length = 567 Score = 29.1 bits (62), Expect = 2.3 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 473 GAPRSHTKPYVRPRDMKKQGPVVVL 547 G P+S + PY +P D+KK V VL Sbjct: 215 GLPKSQSPPYRKPHDLKKMWKVGVL 239 >At3g28360.1 68416.m03544 ABC transporter family protein similar to P-glycoprotein homologue GI:2292907 from [Hordeum vulgare subsp. vulgare] Length = 1158 Score = 28.7 bits (61), Expect = 3.0 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 359 EILTFDQLAIRAPTGKKTVLVQGQRNAREAV 451 E L FD L ++ P+GK LV G + + V Sbjct: 290 ETLIFDDLCLKIPSGKTVALVGGSGSGKSTV 320 >At2g31760.1 68415.m03878 zinc finger protein-related contains low similarity to zinc finger proteins and Pfam PF01485: IBR domain Length = 514 Score = 28.3 bits (60), Expect = 4.0 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 292 EDDGGCSSCYRKSSCTHFGCWRRNSYF*SAGYSCSDWQEDS 414 E GC+ +SC H CW + S Y+C+++ ED+ Sbjct: 286 EKSHGCNHMTCSASCGHRFCWICGKSY-SDHYACNNYVEDA 325 >At4g35730.1 68417.m05071 expressed protein contains Pfam profile: PF03398 eukaryotic protein of unknown function, DUF292 Length = 430 Score = 27.9 bits (59), Expect = 5.2 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +1 Query: 298 DGGCSSCYRKSSCTHFGCWRRNSYF*SAGYSCSDWQEDSTGTRS 429 D SS Y K + G RR+SY + G + SD++E+ T T + Sbjct: 289 DSETSSYYAKPGAENRGMGRRHSYN-NPGINESDYEEEYTNTEA 331 >At3g59820.1 68416.m06675 calcium-binding mitochondrial protein-related contains weak similarity to Calcium-binding mitochondrial protein Anon-60Da (Swiss-Prot:P91927) [Drosophila melanogaster] Length = 755 Score = 27.9 bits (59), Expect = 5.2 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 135 NQIVLRRLFMSRINRPPISVSRLARHMKKPTREGLI 242 +Q V + S INRPP+ + H R+GL+ Sbjct: 34 SQTVHSHAYHSGINRPPVETKPVTEHKSFTRRDGLL 69 >At1g05440.1 68414.m00552 expressed protein ; expression supported by MPSS Length = 393 Score = 27.9 bits (59), Expect = 5.2 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = -2 Query: 448 CLTSISLTLYQYCLLASRSTNSQLIKSKNFSSSSQNACTSF 326 CL S++ TL L +S+ ++L + NF S+ ++ TSF Sbjct: 71 CLDSLNATLDLMPLSVQKSSLTKLSSASNFKSTVESTPTSF 111 >At3g28415.1 68416.m03551 P-glycoprotein, putative contains ATP-binding cassette; related to multi drug resistance proteins Length = 1221 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 371 FDQLAIRAPTGKKTVLVQGQRNAREAV 451 FD L +R P+GK LV G + + V Sbjct: 356 FDDLCLRIPSGKSVALVGGSGSGKSTV 382 >At3g28390.1 68416.m03547 P-glycoprotein, putative similar to P-glycoprotein homologue GI:2292907 from [Hordeum vulgare subsp. vulgare] Length = 1225 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 371 FDQLAIRAPTGKKTVLVQGQRNAREAV 451 FD L +R P+GK LV G + + V Sbjct: 365 FDDLCLRVPSGKTVALVGGSGSGKSTV 391 >At1g32190.1 68414.m03959 expressed protein Length = 422 Score = 27.5 bits (58), Expect = 6.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 307 CSSCYRKSSCTHFGCWR 357 CSSC+ K C CW+ Sbjct: 359 CSSCFGKPKCPKCSCWK 375 >At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 883 Score = 27.1 bits (57), Expect = 9.1 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = +1 Query: 271 RETVQDTEDDGGCSSCY--RKSSCTHFGCWRRNSYF*SAGYSCS 396 R+ + +E GGC+SC KS T C R+ + S G CS Sbjct: 145 RDHGECSESVGGCASCIVRSKSDITTSQCGDRDRRYTSPGNPCS 188 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,376,298 Number of Sequences: 28952 Number of extensions: 288809 Number of successful extensions: 763 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 761 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1141585696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -