BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0590 (707 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochr... 26 0.26 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 22 5.6 >AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q3 protein. Length = 143 Score = 26.2 bits (55), Expect = 0.26 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +1 Query: 391 IVHEWMHILGFLHMQSTHNRDDYVKIVKENITPGLQHNFASTHKIS 528 IV E + +LG LH + T+N +K ++ I L+ + S H IS Sbjct: 39 IVDEMVTVLGDLHRKPTYNNLQEMKYLERAIKESLR-LYPSVHFIS 83 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 21.8 bits (44), Expect = 5.6 Identities = 6/16 (37%), Positives = 9/16 (56%) Frame = -2 Query: 451 LCCGWTACGGSRGCAS 404 +CC +C + CAS Sbjct: 109 ICCSQDSCHADKSCAS 124 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,045 Number of Sequences: 336 Number of extensions: 4454 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18738900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -