BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0589 (787 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35978| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_36095| Best HMM Match : DMP1 (HMM E-Value=3.2) 29 5.6 >SB_35978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 433 REGWDGSPLWVIRSHHSGELIPGK 504 R WDG PL R H G L+PG+ Sbjct: 29 RMTWDGFPLHYSRKHGWGYLVPGR 52 >SB_36095| Best HMM Match : DMP1 (HMM E-Value=3.2) Length = 939 Score = 28.7 bits (61), Expect = 5.6 Identities = 25/86 (29%), Positives = 35/86 (40%) Frame = +3 Query: 486 RTDPRETSIKHRSAYIPHAGKEIPVHNFEVLCAPGNVLRWVPASNGQVPVGAIPAGNSHS 665 R DPR + H A + GK +VL NVL + ++ GQ P A + Sbjct: 819 RNDPRTLNQPHGIA-VMDKGKAEENTGKKVLPTQVNVLDEIVSAQGQEPGNPAQAPGYPA 877 Query: 666 GEPLYIARVNHLKSVTPGKVHPSHGC 743 P Y A+V + PG + GC Sbjct: 878 QAPGYPAQVPGYPAQVPGYPAQAPGC 903 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,621,301 Number of Sequences: 59808 Number of extensions: 481257 Number of successful extensions: 2578 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2576 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2155861620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -