Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= mg--0589
         (787 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK001368-1|BAA91652.1|  864|Homo sapiens protein ( Homo sapiens ...    30   8.2  

>AK001368-1|BAA91652.1|  864|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10506 fis, clone NT2RP2000510. ).
          Length = 864

 Score = 30.3 bits (65), Expect = 8.2
 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 2/68 (2%)
 Frame = +1

Query: 403 TLTHRAFVAGREGWDGSPL--WVIRSHHSGELIPGKLASNTDRLIYLTREKKSLSITLRF 576
           TL  R  +  R   D S L  W + +H+   L   K AS T       R+K S  + + +
Sbjct: 548 TLLQRCLLVSRLYGDESELHFWTVAAHYLHSLSQEKSASTTAPKEAAPRDKLSNPLDICY 607

Query: 577 SVLLETSY 600
           +VL E +Y
Sbjct: 608 NVLCENAY 615


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 112,857,907
Number of Sequences: 237096
Number of extensions: 2457686
Number of successful extensions: 17055
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 16466
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17051
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9590293096
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)