BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0588 (691 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g42870.1 68418.m05225 lipin family protein contains Pfam prof... 34 0.10 At1g64380.1 68414.m07296 AP2 domain-containing transcription fac... 31 0.95 At5g43630.1 68418.m05333 zinc knuckle (CCHC-type) family protein... 29 3.8 At1g44120.1 68414.m05096 C2 domain-containing protein / armadill... 28 6.7 At4g11560.1 68417.m01853 bromo-adjacent homology (BAH) domain-co... 27 8.9 >At5g42870.1 68418.m05225 lipin family protein contains Pfam profile: PF04571 lipin, N-terminal conserved region Length = 930 Score = 33.9 bits (74), Expect = 0.10 Identities = 30/92 (32%), Positives = 38/92 (41%) Frame = -1 Query: 493 SYCSSDVTDNDVVCEGDGSGSLSNDVLKGKSSGSERPQDAAENADFSFSGTD*C*NSGNS 314 S S V D + + D S + +SG Q E FSFS D C GNS Sbjct: 353 SSTGSPVQDENKITIKDMHISAGDFEKSQSASGESILQPEIEEEQFSFSDLDECKPGGNS 412 Query: 313 QD*VESGADVADTTQMQGAESSALTSVTRPEK 218 G+ +DT ++ G ES T T PEK Sbjct: 413 ----SVGSSSSDTVKVDGKESYDETK-TSPEK 439 >At1g64380.1 68414.m07296 AP2 domain-containing transcription factor, putative contains Pfam profile: PF00847 AP2 domain Length = 335 Score = 30.7 bits (66), Expect = 0.95 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = -2 Query: 546 SNFASEEIDLEVSLTSPIVIAAPMSLTMMLSARETEAVASATT-FSRASPPEAKDLRTRL 370 +NF+ + ++ SL+ I+ P +L + S +V SATT F+ +PP L + + Sbjct: 10 NNFSPKISEIRASLSQIILAGGPNTLDSIFSLLTPSSVESATTSFNTHNPPPPPQLGSSV 69 Query: 369 KMR 361 +R Sbjct: 70 YLR 72 >At5g43630.1 68418.m05333 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 831 Score = 28.7 bits (61), Expect = 3.8 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -1 Query: 487 CSSDVTDNDVVCEGDGSGSLSNDVLKGKSSGSERPQDAAEN 365 CS +D+ EG+ L N+ L+ +S+GS+ D A N Sbjct: 142 CSKRSSDSPKAMEGETRDLLVNEQLRMESAGSQEEGDKAHN 182 >At1g44120.1 68414.m05096 C2 domain-containing protein / armadillo/beta-catenin repeat family protein similar to CCLS 65 [Silene latifolia] GI:2570102; contains Pfam profiles PF00514: Armadillo/beta-catenin-like repeat, PF00168: C2 domain Length = 2114 Score = 27.9 bits (59), Expect = 6.7 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -1 Query: 487 CSSDVTDNDVVCEGDGSGSLSNDVLKGKSSGSERPQDAAE 368 CSS ++ VV EG+G ++ ++ + KS+ E D+ E Sbjct: 990 CSSHPSNRLVVMEGNGLEIIAENLQRNKSNTQENSSDSEE 1029 >At4g11560.1 68417.m01853 bromo-adjacent homology (BAH) domain-containing protein contains Pfam profile PF01426: BAH domain Length = 587 Score = 27.5 bits (58), Expect = 8.9 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +3 Query: 63 DVDFEPNSQRILDIMISNLFNEIGEL 140 D D+E + QR +D+++ N +G+L Sbjct: 249 DKDYEDSKQREIDVLVKKTMNVLGDL 274 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,397,091 Number of Sequences: 28952 Number of extensions: 250026 Number of successful extensions: 728 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 728 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1467502800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -