BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0587 (624 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 25 1.5 AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 23 7.9 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +1 Query: 316 LVELGFAKASFPKELKKNTIESQIAPALLSAEAQAKSLRNGIW 444 ++++ K ++L NT+ + A LL +E A NG W Sbjct: 3 ILQININKCRIAQDLALNTMRVEKADVLLLSELYAVPQNNGNW 45 Score = 23.0 bits (47), Expect = 7.9 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = +2 Query: 119 PPLPVKLWGIEVVSGNAVNWL 181 P +P+++ G+E+ S A+ +L Sbjct: 717 PEIPIRVGGLEIRSKQAIRYL 737 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 23.0 bits (47), Expect = 7.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 Query: 72 SITKPQYIYRYGIPVNLH 125 S TKP I RY IP+ L+ Sbjct: 193 SYTKPTPIQRYAIPIILN 210 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 662,924 Number of Sequences: 2352 Number of extensions: 13247 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60632475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -