BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0583 (648 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 ... 145 4e-37 DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein ... 24 1.5 AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein ... 24 1.5 DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein ... 22 4.4 AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein ... 22 4.4 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 22 5.9 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 22 5.9 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 22 5.9 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 7.8 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 21 7.8 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 21 7.8 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 21 7.8 >AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 protein. Length = 208 Score = 145 bits (351), Expect = 4e-37 Identities = 65/72 (90%), Positives = 70/72 (97%) Frame = +1 Query: 37 GKRAPIRKKRKYELGRPAANTRLGPQRIHSVRSRGGNTKYRALRLDTGNFSWGSECSTRK 216 GKR PIRKKRK+ELGRPAANT+LGPQRIH+VR+RGGN KYRALRLDTGNFSWGSEC+TRK Sbjct: 16 GKRKPIRKKRKFELGRPAANTKLGPQRIHTVRTRGGNKKYRALRLDTGNFSWGSECTTRK 75 Query: 217 TRIIDVVYNASN 252 TRIIDVVYNASN Sbjct: 76 TRIIDVVYNASN 87 Score = 144 bits (349), Expect = 6e-37 Identities = 68/85 (80%), Positives = 74/85 (87%) Frame = +3 Query: 255 ELVRTKTLVKNAIVVVDATPFRQWYESHYTLPLGRKKGAKLTEAEEAIINKKRSQKTARK 434 ELVRTKTLVKNAIV +DATPFRQWYE HY LPLGRK+GAKLTEAEE ++NKKRS+K K Sbjct: 89 ELVRTKTLVKNAIVTIDATPFRQWYEGHYVLPLGRKRGAKLTEAEEEVLNKKRSKKAEAK 148 Query: 435 YLARQRLAKVEGALEEQFHTGRLLA 509 Y ARQR AKVE ALEEQF TGR+LA Sbjct: 149 YKARQRFAKVEPALEEQFATGRVLA 173 Score = 71.3 bits (167), Expect = 7e-15 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = +2 Query: 509 CVASRPGQCGRADGYILEGKELEFYLRKIKSKRAK 613 C++SRPGQCGR DGYILEGKELEFY+R+IKSK+AK Sbjct: 174 CISSRPGQCGREDGYILEGKELEFYMRRIKSKKAK 208 Score = 31.5 bits (68), Expect = 0.007 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 3 RDHWHKRRATG 35 RDHWHKRRATG Sbjct: 5 RDHWHKRRATG 15 >DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein 4 protein. Length = 128 Score = 23.8 bits (49), Expect = 1.5 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -2 Query: 299 YNNCILDKGLCT 264 Y NC+LD+G CT Sbjct: 46 YVNCLLDQGPCT 57 >AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein protein. Length = 128 Score = 23.8 bits (49), Expect = 1.5 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -2 Query: 299 YNNCILDKGLCT 264 Y NC+LD+G CT Sbjct: 46 YVNCLLDQGPCT 57 >DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein 6 protein. Length = 125 Score = 22.2 bits (45), Expect = 4.4 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -2 Query: 299 YNNCILDKGLCTHQ 258 Y C+LD+G CT++ Sbjct: 43 YIKCMLDEGPCTNE 56 >AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein protein. Length = 125 Score = 22.2 bits (45), Expect = 4.4 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -2 Query: 299 YNNCILDKGLCTHQ 258 Y C+LD+G CT++ Sbjct: 43 YIKCMLDEGPCTNE 56 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 332 LIPLPEWSCIYYNNC 288 L P P+WS Y++C Sbjct: 104 LQPYPDWSFAKYDDC 118 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 332 LIPLPEWSCIYYNNC 288 L P P+WS Y++C Sbjct: 104 LQPYPDWSFAKYDDC 118 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 332 LIPLPEWSCIYYNNC 288 L P P+WS Y++C Sbjct: 104 LQPYPDWSFAKYDDC 118 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.4 bits (43), Expect = 7.8 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 332 LIPLPEWSCIYYNNC 288 L P P+WS Y +C Sbjct: 109 LQPYPDWSFAKYEDC 123 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.4 bits (43), Expect = 7.8 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 332 LIPLPEWSCIYYNNC 288 L P P+WS Y +C Sbjct: 110 LRPYPDWSFAKYEDC 124 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.4 bits (43), Expect = 7.8 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 332 LIPLPEWSCIYYNNC 288 L P P+WS Y +C Sbjct: 108 LQPYPDWSWANYKDC 122 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.4 bits (43), Expect = 7.8 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 332 LIPLPEWSCIYYNNC 288 L P P+WS Y +C Sbjct: 108 LQPYPDWSWANYKDC 122 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,004 Number of Sequences: 438 Number of extensions: 3321 Number of successful extensions: 19 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -