BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0582 (660 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC26H5.04 |||vacuolar import and degradation protein Vid28|Sch... 26 4.2 SPBC1289.12 |usp109||U1 snRNP-associated protein Usp109|Schizosa... 26 5.5 SPBC2F12.15c |||palmitoyltransferase|Schizosaccharomyces pombe|c... 25 7.3 >SPAC26H5.04 |||vacuolar import and degradation protein Vid28|Schizosaccharomyces pombe|chr 1|||Manual Length = 729 Score = 26.2 bits (55), Expect = 4.2 Identities = 13/45 (28%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Frame = +3 Query: 90 DLLQRTNLGT--INTYLLYNSSLKHSPGCVTCVNETTNRISRSKI 218 D+L+ +NL + ++ +LYNS + SP + + + TNR ++ ++ Sbjct: 162 DVLRISNLSSKILHRLILYNSKVGDSPRFCSALFQITNRATQLRL 206 >SPBC1289.12 |usp109||U1 snRNP-associated protein Usp109|Schizosaccharomyces pombe|chr 2|||Manual Length = 352 Score = 25.8 bits (54), Expect = 5.5 Identities = 16/30 (53%), Positives = 19/30 (63%) Frame = -1 Query: 171 RSLENASTRSCKVNTYLSSPDLYVVGDPRP 82 RS+ S +S K NTYLSSP Y G P+P Sbjct: 140 RSILVHSVKSDK-NTYLSSPGFY--GTPQP 166 >SPBC2F12.15c |||palmitoyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 329 Score = 25.4 bits (53), Expect = 7.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 285 YMYICYGKSRYCGKCTHF 338 YM + GKSR+C KC + Sbjct: 88 YMTLQNGKSRFCEKCQEY 105 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,758,761 Number of Sequences: 5004 Number of extensions: 58109 Number of successful extensions: 121 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 121 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 299817502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -