BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0582 (660 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0473 - 3639533-3639598,3639848-3639955,3640037-3640126,364... 30 1.4 05_06_0226 + 26561673-26562908 29 3.3 >03_01_0473 - 3639533-3639598,3639848-3639955,3640037-3640126, 3640203-3640394,3640952-3641018,3641472-3641512, 3641762-3641779,3641984-3642055,3642154-3642237, 3642296-3642373,3642703-3642759,3643374-3643469 Length = 322 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = -2 Query: 371 LNEEANVHIYRKMCTFAAISTFTVTYIHI 285 L EE+NV I MCT+ + TF+ Y+H+ Sbjct: 44 LMEESNVQIAHSMCTYNSAKTFS-KYLHV 71 >05_06_0226 + 26561673-26562908 Length = 411 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = +2 Query: 488 NARNAPHTP*PNLTCDILYNVQRKV-CFVCHLH 583 +A +P P P+L+ D+LY + R++ C V LH Sbjct: 2 SAAQSPRRPWPHLSDDLLYEIVRRIPCEVDRLH 34 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,649,415 Number of Sequences: 37544 Number of extensions: 334757 Number of successful extensions: 770 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 770 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1655832080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -