BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0582 (660 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_37853| Best HMM Match : REJ (HMM E-Value=0.00025) 30 1.5 SB_13995| Best HMM Match : ASC (HMM E-Value=0.0034) 28 7.7 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/28 (46%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = -2 Query: 605 ENYLLLKNVNDK-QNILFFAHYIICRRL 525 ENY+LL+ ++ Q L+FA+YI+ R+L Sbjct: 104 ENYILLRKLHSTAQTTLYFANYILLRKL 131 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/68 (25%), Positives = 37/68 (54%), Gaps = 1/68 (1%) Frame = -2 Query: 638 LYEHNTKSFNNENYLLLKNVN-DKQNILFFAHYIICRRLG*VKVCEAHFSH*RFHILYAM 462 L+ +F NY++L+ ++ Q L+FA+YI+ R+L + F + + +L + Sbjct: 150 LHSTTQATFYYANYIILRKLHYTAQTTLYFANYILLRKLH--STTQITFYYANYILLRKL 207 Query: 461 FTYTKSTW 438 + T++T+ Sbjct: 208 HSSTQATF 215 >SB_37853| Best HMM Match : REJ (HMM E-Value=0.00025) Length = 2182 Score = 30.3 bits (65), Expect = 1.5 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -3 Query: 463 CSHIPNRHGHCE 428 C H+P +HGHCE Sbjct: 237 CDHVPRKHGHCE 248 >SB_13995| Best HMM Match : ASC (HMM E-Value=0.0034) Length = 610 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -2 Query: 197 IGSFIDARHAAWRMLQRGVVK*IRIY 120 IGS+++ RHAAW L +++ ++IY Sbjct: 136 IGSYLNYRHAAWLRLIHNILR-VKIY 160 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,243,052 Number of Sequences: 59808 Number of extensions: 421054 Number of successful extensions: 747 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 672 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 737 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -