BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0582 (660 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z22176-13|CAO82058.1| 1185|Caenorhabditis elegans Hypothetical p... 29 2.2 Z83219-5|CAM35834.1| 390|Caenorhabditis elegans Hypothetical pr... 27 8.9 >Z22176-13|CAO82058.1| 1185|Caenorhabditis elegans Hypothetical protein ZK1098.10d protein. Length = 1185 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = -1 Query: 153 STRSCKVNTYLSSPDLYVVGDPRPRAFRASRLTLLKPMPPPATR 22 S+ K T LS VV D P+ +L P+PPPA R Sbjct: 773 SSAPVKAKTKLSRVSENVVPDETPKLIPLEKLKKEDPLPPPANR 816 >Z83219-5|CAM35834.1| 390|Caenorhabditis elegans Hypothetical protein C31C9.8 protein. Length = 390 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -2 Query: 611 NNENYLLLKNVNDKQNI 561 N+ENY LLKNV + Q+I Sbjct: 221 NHENYFLLKNVREVQHI 237 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,506,191 Number of Sequences: 27780 Number of extensions: 339306 Number of successful extensions: 646 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 643 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 646 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1476380920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -