BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0582 (660 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 29 2.1 At5g06630.1 68418.m00749 proline-rich extensin-like family prote... 28 6.3 At4g08410.1 68417.m01390 proline-rich extensin-like family prote... 28 6.3 At5g06640.1 68418.m00750 proline-rich extensin-like family prote... 27 8.4 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -1 Query: 129 TYLSSPDLYVVGDPRPRAFRASRLTLLKPMPPP 31 TY SSP YV P P + S + K PPP Sbjct: 453 TYKSSPPPYVYSSPPPPYYSPSPKVVYKSPPPP 485 >At5g06630.1 68418.m00749 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 440 Score = 27.9 bits (59), Expect = 6.3 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = -1 Query: 150 TRSCKVNTYLSSPDLYVVGDPRPRAFRASRLTLLKPMPPP 31 T S KVN Y S P YV P P + S K PPP Sbjct: 69 TPSPKVN-YKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPP 107 >At4g08410.1 68417.m01390 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 707 Score = 27.9 bits (59), Expect = 6.3 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -1 Query: 144 SCKVNTYLSSPDLYVVGDPRPRAFRASRLTLLKPMPPP 31 S KVN Y S P YV G P P + S K PPP Sbjct: 268 SPKVN-YKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPP 304 Score = 27.9 bits (59), Expect = 6.3 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -1 Query: 144 SCKVNTYLSSPDLYVVGDPRPRAFRASRLTLLKPMPPP 31 S KVN Y S P YV G P P + S K PPP Sbjct: 318 SPKVN-YKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPP 354 >At5g06640.1 68418.m00750 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 689 Score = 27.5 bits (58), Expect = 8.4 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = -1 Query: 144 SCKVNTYLSSPDLYVVGDPRPRAFRASRLTLLKPMPPP 31 S KVN Y S P YV P P + S + K PPP Sbjct: 570 SPKVN-YKSPPPPYVYSSPPPPYYSPSPMVDYKSTPPP 606 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,843,033 Number of Sequences: 28952 Number of extensions: 284889 Number of successful extensions: 761 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 520 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 761 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1383534864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -