BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0580 (772 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578806-1|AAT07311.1| 110|Anopheles gambiae myoglianin protein. 24 6.0 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 7.9 AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein p... 23 7.9 >AY578806-1|AAT07311.1| 110|Anopheles gambiae myoglianin protein. Length = 110 Score = 23.8 bits (49), Expect = 6.0 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 33 TCTFRFRTTLVPCSAPKNYSSISL 104 T + T+ +PC +PK +SI L Sbjct: 62 THVMQLSTSAIPCCSPKKMNSIRL 85 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.4 bits (48), Expect = 7.9 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -2 Query: 558 GIRNSSKQCYYK*ISNCINPKYTYQH 481 G + S Q K NC+N TY H Sbjct: 1687 GPNDGSSQTEMKPKQNCVNSSNTYNH 1712 >AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein protein. Length = 344 Score = 23.4 bits (48), Expect = 7.9 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +1 Query: 229 AAGSVLDNKNL-LNHYKSSGNSGKRKEVWKLCH 324 AAG+ N+ L ++S N GK K W +CH Sbjct: 235 AAGTQWARINVSLPDFQSFLNLGKLKVGWSICH 267 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 833,905 Number of Sequences: 2352 Number of extensions: 16499 Number of successful extensions: 32 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -