BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0578 (574 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. 23 5.3 AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. 23 7.1 AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol ... 23 9.3 >DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. Length = 353 Score = 23.4 bits (48), Expect = 5.3 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = -1 Query: 181 YLKKMSMSVIMSIFFHLIAMKLGIVLYGTPANV 83 ++K + ++ M++ + AM L +LY PAN+ Sbjct: 69 FIKLVYQNIFMAMQSMIRAMDLLKILYSDPANI 101 >AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. Length = 406 Score = 23.0 bits (47), Expect = 7.1 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -3 Query: 197 RFLSVLFKKNVYVCYYVYFFPSNCDETWHSSLWNSSE 87 R L+VLF + V VYF D++W + W SE Sbjct: 2 RTLAVLFAAFLAVNAKVYFEEGFKDDSWQKT-WVQSE 37 >AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol kinase protein. Length = 555 Score = 22.6 bits (46), Expect = 9.3 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 Query: 486 FLIYNLNTYCVQN 448 FL+YN T CVQ+ Sbjct: 283 FLLYNTGTRCVQS 295 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 608,542 Number of Sequences: 2352 Number of extensions: 12117 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54245403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -