BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0578 (574 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 26 0.23 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 26 0.23 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 26 0.30 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 22 3.8 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 22 3.8 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 22 3.8 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 22 3.8 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 22 3.8 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 22 3.8 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 3.8 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 5.0 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 21 6.6 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 6.6 AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 21 6.6 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 8.7 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 21 8.7 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 26.2 bits (55), Expect = 0.23 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -2 Query: 537 YVKKQNNIL*SYCNSYDFLIYNLN 466 Y NN YCN+Y L YN+N Sbjct: 89 YNYNNNNYKKLYCNNYKKLYYNIN 112 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 26.2 bits (55), Expect = 0.23 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -2 Query: 537 YVKKQNNIL*SYCNSYDFLIYNLN 466 Y NN YCN+Y L YN+N Sbjct: 89 YNYNNNNYKKLYCNNYKKLYYNIN 112 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 25.8 bits (54), Expect = 0.30 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -2 Query: 537 YVKKQNNIL*SYCNSYDFLIYNLN 466 Y NN YCN+Y L YN+N Sbjct: 89 YNYNNNNYKKLYCNNYRKLYYNIN 112 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.2 bits (45), Expect = 3.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 528 KQNNIL*SYCNSYDFLIYNLNTY 460 K+ I+ S N+Y++ YN N Y Sbjct: 77 KEPKIISSLSNNYNYSNYNNNNY 99 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.2 bits (45), Expect = 3.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 528 KQNNIL*SYCNSYDFLIYNLNTY 460 K+ I+ S N+Y++ YN N Y Sbjct: 77 KEPKIISSLSNNYNYSNYNNNNY 99 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.2 bits (45), Expect = 3.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 528 KQNNIL*SYCNSYDFLIYNLNTY 460 K+ I+ S N+Y++ YN N Y Sbjct: 77 KEPKIISSLSNNYNYSNYNNNNY 99 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.2 bits (45), Expect = 3.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 528 KQNNIL*SYCNSYDFLIYNLNTY 460 K+ I+ S N+Y++ YN N Y Sbjct: 77 KEPKIISSLSNNYNYSNYNNNNY 99 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.2 bits (45), Expect = 3.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 528 KQNNIL*SYCNSYDFLIYNLNTY 460 K+ I+ S N+Y++ YN N Y Sbjct: 77 KEPKIISSLSNNYNYSNYNNNNY 99 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.2 bits (45), Expect = 3.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 528 KQNNIL*SYCNSYDFLIYNLNTY 460 K+ I+ S N+Y++ YN N Y Sbjct: 77 KEPKIISSLSNNYNYSNYNNNNY 99 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/46 (21%), Positives = 24/46 (52%) Frame = -1 Query: 193 FFQCYLKKMSMSVIMSIFFHLIAMKLGIVLYGTPANVSVIVPSTLI 56 F + ++++ + ++ H++A I++ G + IV +TLI Sbjct: 2 FTENVVEELLSPLTLNRITHILANSPAIIILGQDSKAKAIVVNTLI 47 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -1 Query: 136 HLIAMKLGIVLYGTPANVSVIVPSTLI 56 H++A I++ G + IV +TLI Sbjct: 59 HILANSPAIIILGQDSKAKAIVVNTLI 85 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 6.6 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 178 NNTERNLLNKSNTHIYSLCIYLIIN 252 NN N N NT+ L Y IIN Sbjct: 95 NNNYNNYNNNYNTNYKKLQYYNIIN 119 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.4 bits (43), Expect = 6.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 522 NNIL*SYCNSYDFLIYNLN 466 NN +Y N+Y L YN+N Sbjct: 338 NNYNNNYNNNYKKLYYNIN 356 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 21.4 bits (43), Expect = 6.6 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 4/55 (7%) Frame = -2 Query: 477 YNLNTYCVQNNCIYVSVFFLSHTIVT--VILNNVFRQINKKEKYTI--CEQKFLH 325 Y L Y + NC YV+++ S ++ V ++N E TI C++ H Sbjct: 206 YTLRNYGRRINCTYVALYPSSVQVIALGVGVSNFLSSTRTAETGTIRKCDESSPH 260 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 142 FFHLIAMKLGIVLYGTPA 89 F +I+M G+VLY TP+ Sbjct: 164 FCAVISMHDGLVLYTTPS 181 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 142 FFHLIAMKLGIVLYGTPA 89 F +I+M G+VLY TP+ Sbjct: 159 FCAVISMHDGLVLYTTPS 176 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,756 Number of Sequences: 438 Number of extensions: 3914 Number of successful extensions: 17 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16504155 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -