BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0573 (396 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1805.11c |rps2602|rps26-2|40S ribosomal protein S26|Schizosa... 127 5e-31 SPAC806.03c |rps2601|rps26-1, rps26|40S ribosomal protein S26|Sc... 124 5e-30 SPCC126.15c |sec65||signal recognition particle subunit Sec65 |S... 29 0.35 SPCC553.04 |cyp9||WD repeat containing cyclophilin family peptid... 25 3.2 SPBC1289.07c |rpc40|rpa42|DNA-directed RNA polymerase I and III ... 25 3.2 SPCC10H11.01 |prp11||ATP-dependent RNA helicase Prp11|Schizosacc... 25 4.3 SPBC409.12c |||nuclear telomere cap complex subunit Stn1|Schizos... 24 7.4 SPBC21.05c |ral2||Ras guanyl-nucleotide exchange factor Ral2 |Sc... 24 9.8 SPAC821.13c ||SPAC955.01c|P-type ATPase |Schizosaccharomyces pom... 24 9.8 SPBC1A4.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 24 9.8 SPAC2F7.08c |snf5||chromatin remodeling complex subunit Snf5 |Sc... 24 9.8 >SPAC1805.11c |rps2602|rps26-2|40S ribosomal protein S26|Schizosaccharomyces pombe|chr 1|||Manual Length = 119 Score = 127 bits (307), Expect = 5e-31 Identities = 55/78 (70%), Positives = 66/78 (84%) Frame = +1 Query: 22 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 201 MT+KRRN GR KHGRGHVK VRC NC+R VPKDKAIK++ IRN+VE AA+RD+++ASVY Sbjct: 1 MTQKRRNNGRNKHGRGHVKFVRCINCSRAVPKDKAIKRWTIRNMVETAAIRDLSEASVYS 60 Query: 202 MFQLPKLYAKLHYCVSCA 255 + +PKLY KL YCVSCA Sbjct: 61 EYTIPKLYIKLQYCVSCA 78 Score = 35.9 bits (79), Expect = 0.002 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 3/39 (7%) Frame = +3 Query: 255 IHSKVVRNRSKKDRRIRT-PPKSNFPRDMSR--PQAVQR 362 IHS+VVR RS++ RRIRT PP+ + RD + P AV + Sbjct: 79 IHSRVVRVRSREGRRIRTPPPRVRYNRDGKKVNPTAVAK 117 >SPAC806.03c |rps2601|rps26-1, rps26|40S ribosomal protein S26|Schizosaccharomyces pombe|chr 1|||Manual Length = 120 Score = 124 bits (299), Expect = 5e-30 Identities = 54/83 (65%), Positives = 68/83 (81%) Frame = +1 Query: 22 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 201 MT+KRRN GR KHGRGH K VRC NC+R VPKDKAIK++ IRN+VE AA+RD+++ASVY Sbjct: 1 MTQKRRNCGRNKHGRGHTKFVRCINCSRAVPKDKAIKRWNIRNMVETAAIRDLSEASVYS 60 Query: 202 MFQLPKLYAKLHYCVSCASTAKL 270 + +PK+Y KL YCVSCA A++ Sbjct: 61 EYAIPKIYVKLQYCVSCAIHARV 83 Score = 35.5 bits (78), Expect = 0.003 Identities = 19/39 (48%), Positives = 27/39 (69%), Gaps = 3/39 (7%) Frame = +3 Query: 255 IHSKVVRNRSKKDRRIRT-PPKSNFPRDMSR--PQAVQR 362 IH++VVR RS++ RRIRT PP+ + RD R P A+ + Sbjct: 79 IHARVVRVRSREGRRIRTPPPRVRYNRDGKRVNPAAIAK 117 >SPCC126.15c |sec65||signal recognition particle subunit Sec65 |Schizosaccharomyces pombe|chr 3|||Manual Length = 199 Score = 28.7 bits (61), Expect = 0.35 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +1 Query: 103 RCVPKDKAIKKFVIRNIVEAAAVRDI 180 RCVPKDKAI + +NI A VRD+ Sbjct: 20 RCVPKDKAILNPLAKNI--ADVVRDL 43 >SPCC553.04 |cyp9||WD repeat containing cyclophilin family peptidyl-prolyl cis-trans isomerase Cyp9|Schizosaccharomyces pombe|chr 3|||Manual Length = 610 Score = 25.4 bits (53), Expect = 3.2 Identities = 11/40 (27%), Positives = 24/40 (60%) Frame = -1 Query: 162 RFYDVPNHELFDGLVLWHAPRAVCASHGFNVTTSMLGASS 43 + +DV + +L + + L P+A+C + ++ TS++ SS Sbjct: 115 KVFDVESIDLVNIIDLEFLPKAICCFNSPSLKTSLIAVSS 154 >SPBC1289.07c |rpc40|rpa42|DNA-directed RNA polymerase I and III subunit Rpc40 |Schizosaccharomyces pombe|chr 2|||Manual Length = 348 Score = 25.4 bits (53), Expect = 3.2 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 268 LSGTDRRKTEESVLLPRVTSLGT 336 ++ DR +TE SVL RVT +G+ Sbjct: 1 MAAVDRSRTEISVLSDRVTDVGS 23 >SPCC10H11.01 |prp11||ATP-dependent RNA helicase Prp11|Schizosaccharomyces pombe|chr 3|||Manual Length = 1014 Score = 25.0 bits (52), Expect = 4.3 Identities = 22/93 (23%), Positives = 40/93 (43%), Gaps = 2/93 (2%) Frame = +1 Query: 109 VPKDKAIKKFVIRNIVEAAAVRDINDASVYPMFQLPKLY--AKLHYCVSCASTAKLSGTD 282 +PKDKA++ RN + A I DA + + + + +K S KL+ Sbjct: 167 IPKDKAVENNHQRNAEKPVASDKITDAKLLARLERVRAWKESKAKQEASKKEEHKLNTKP 226 Query: 283 RRKTEESVLLPRVTSLGTCHVHRQCKGSDLLLN 381 + ++ +P T + ++RQ SD+ N Sbjct: 227 QVTAKDQNAMPS-TGISGFEINRQKDTSDMKRN 258 >SPBC409.12c |||nuclear telomere cap complex subunit Stn1|Schizosaccharomyces pombe|chr 2|||Manual Length = 325 Score = 24.2 bits (50), Expect = 7.4 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 249 MRIHSKVVRNRSKKDRRIRTPPKSNFPRDMSR 344 MR + + IRTP KS FP+D ++ Sbjct: 140 MRYKKNLTKISKNHHSIIRTPKKSYFPKDHAK 171 >SPBC21.05c |ral2||Ras guanyl-nucleotide exchange factor Ral2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 611 Score = 23.8 bits (49), Expect = 9.8 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = -3 Query: 394 YFIIYLIINHFLCTACGRDMS 332 Y ++ +++H+L CG+D+S Sbjct: 165 YGHLHCVLDHYLIIFCGQDLS 185 >SPAC821.13c ||SPAC955.01c|P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1562 Score = 23.8 bits (49), Expect = 9.8 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +1 Query: 97 CARCVPKDKAIKKFVIRNIVEAAAVRDINDAS 192 C R P KA+ +RN +E A I D + Sbjct: 1214 CCRSSPMQKALMVQKVRNTLEKAVTLAIGDGA 1245 >SPBC1A4.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 249 Score = 23.8 bits (49), Expect = 9.8 Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 3/25 (12%) Frame = -1 Query: 78 FNVTTSMLGASSITAL---TSHVSN 13 FN+ TS +SS+T+ +SH+SN Sbjct: 100 FNILTSNFASSSVTSAPTQSSHISN 124 >SPAC2F7.08c |snf5||chromatin remodeling complex subunit Snf5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 632 Score = 23.8 bits (49), Expect = 9.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 16 RNMTRKRRNGGRAKHG 63 R R RR GRAKHG Sbjct: 378 REARRMRRRQGRAKHG 393 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,479,546 Number of Sequences: 5004 Number of extensions: 25576 Number of successful extensions: 62 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 59 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 62 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 132093910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -