BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0572 (420 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L23645-9|AAK26134.1| 1226|Caenorhabditis elegans Hypothetical pr... 27 4.1 U58750-6|AAB00646.1| 2049|Caenorhabditis elegans Rod (drosophila... 26 9.5 >L23645-9|AAK26134.1| 1226|Caenorhabditis elegans Hypothetical protein F54F2.1 protein. Length = 1226 Score = 27.5 bits (58), Expect = 4.1 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 252 SDANPGRLNQTNFFINRPGIFFGQ 323 S A PG+ NQ FI PG+++ Q Sbjct: 195 SAAVPGKKNQNRVFIGAPGVWYWQ 218 >U58750-6|AAB00646.1| 2049|Caenorhabditis elegans Rod (drosophila roughdeal) homologprotein 1 protein. Length = 2049 Score = 26.2 bits (55), Expect = 9.5 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 4/38 (10%) Frame = -2 Query: 149 SNSRNSLFFISLDGIIYESNSILLKSEYS----YLQYH 48 S+S NS +S D ++YE NS+++ S YL +H Sbjct: 1602 SDSYNSDLALSSDAMVYERNSVIISDLPSLAEQYLPFH 1639 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,654,080 Number of Sequences: 27780 Number of extensions: 131683 Number of successful extensions: 184 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 184 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 184 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 682028672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -