BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0567 (728 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g29560.1 68414.m03615 expressed protein ; expression supporte... 28 7.3 At1g01360.1 68414.m00051 expressed protein similar to hypothetic... 28 7.3 >At1g29560.1 68414.m03615 expressed protein ; expression supported by MPSS Length = 521 Score = 27.9 bits (59), Expect = 7.3 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -3 Query: 492 ISE*ARGKRCSASADSRYHRSGLNEALPLPYLGRVKDVTE 373 +S+ +G ADS Y RS + + LP R+KDV E Sbjct: 82 LSDSGKGSDEIQKADSVYKRSNADTRVSLPQQRRLKDVVE 121 >At1g01360.1 68414.m00051 expressed protein similar to hypothetical protein GB:CAB45785 GI:5262156 from [Arabidopsis thaliana] Length = 187 Score = 27.9 bits (59), Expect = 7.3 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 258 HSRPLCQKKMKTSALLRHIHT*FHFVNKIV 169 H + LC++ TSAL++HI H V +V Sbjct: 24 HHQHLCRENQCTSALVKHIKAPLHLVWSLV 53 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,210,979 Number of Sequences: 28952 Number of extensions: 277565 Number of successful extensions: 559 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 559 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1594686376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -