BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0564 (628 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 23 1.6 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 1.6 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 23 2.1 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 21 6.4 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 21 6.4 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 23.4 bits (48), Expect = 1.6 Identities = 13/49 (26%), Positives = 22/49 (44%) Frame = +1 Query: 289 TAAHCWRTRRAQARXFTLALGTANIFSGGTRVTTSNVQMHGSYNMDTLH 435 T A T+R + + TLA+ N + G + T G + ++LH Sbjct: 4 TGADRLMTQRCKEKLNTLAISVMNQWPGVRLLVTEGWDEEGYHTPESLH 52 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.4 bits (48), Expect = 1.6 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 Query: 517 TLLVLGPGLQASEGPPMLLREP 582 TLLVLG + P+ +REP Sbjct: 8 TLLVLGASAEDDTSGPVFVREP 29 Score = 21.4 bits (43), Expect = 6.4 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = +2 Query: 338 PSXLAQLTSSPEAPGSPPPMSR 403 PS + ++ E PG PP R Sbjct: 982 PSETVTIITAEEVPGGPPTSIR 1003 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 23.0 bits (47), Expect = 2.1 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -3 Query: 224 SQVQQDGGEHQRWRQNHPQSWYRRSQRL 141 S V D G + + H W+RR RL Sbjct: 2 SGVVGDAGRASKGQDKHMVHWFRRGLRL 29 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.4 bits (43), Expect = 6.4 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +1 Query: 346 LGTANIFSGGTRVTTSNVQMHGSYNMDTLHNYVAIIN 456 LGT + S G + T + +++ L +VAI N Sbjct: 118 LGTGLLTSTGLKWQTRRKILTPAFHFSILQQFVAIFN 154 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.4 bits (43), Expect = 6.4 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +1 Query: 346 LGTANIFSGGTRVTTSNVQMHGSYNMDTLHNYVAIIN 456 LGT + S G + T + +++ L +VAI N Sbjct: 118 LGTGLLTSTGLKWQTRRKILTPAFHFSILQQFVAIFN 154 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,961 Number of Sequences: 336 Number of extensions: 2319 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16083914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -