BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0563 (679 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57667| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_55417| Best HMM Match : Kelch_2 (HMM E-Value=4.8e-23) 28 8.0 >SB_57667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 799 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = -2 Query: 384 ERGPLLRVMLQHPDVGAATLTSRVQRVGSPDWEGNI 277 E G ++++ P +G TLT + R + DWEG++ Sbjct: 635 EEGEIIKLAKALPQMGNNTLTKDMLREYAGDWEGHL 670 >SB_55417| Best HMM Match : Kelch_2 (HMM E-Value=4.8e-23) Length = 1153 Score = 27.9 bits (59), Expect = 8.0 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = +2 Query: 326 SVAAPTSGCCSITRSRGPRSQG--GNVHSGTSVS 421 SVAAPTS S S PR QG G + + T +S Sbjct: 875 SVAAPTSAQYSAVTSSSPRGQGVAGAIQTSTPLS 908 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,488,876 Number of Sequences: 59808 Number of extensions: 502413 Number of successful extensions: 1289 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1288 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -