BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0560 (655 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 pro... 30 0.056 AJ973476-1|CAJ01523.1| 126|Anopheles gambiae hypothetical prote... 26 1.2 AJ697729-1|CAG26922.1| 126|Anopheles gambiae putative sensory a... 26 1.2 AJ973475-1|CAJ01522.1| 127|Anopheles gambiae hypothetical prote... 25 2.8 AJ697728-1|CAG26921.1| 127|Anopheles gambiae putative sensory a... 25 2.8 AJ973471-1|CAJ01518.1| 122|Anopheles gambiae hypothetical prote... 24 3.7 AJ697731-1|CAG26924.1| 122|Anopheles gambiae putative chemosens... 24 3.7 AJ697730-1|CAG26923.1| 122|Anopheles gambiae putative chemosens... 24 3.7 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 24 3.7 Z49814-1|CAA89968.1| 137|Anopheles gambiae serine proteinase pr... 24 4.8 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 21 5.1 AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 23 6.4 AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein p... 23 8.4 >DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 protein. Length = 545 Score = 30.3 bits (65), Expect = 0.056 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = -1 Query: 163 IVRDYFHTLAVTISYYGEYERIPL 92 I R+YF+T++V +YGE ER P+ Sbjct: 310 IWREYFYTMSVQNPHYGEMERNPI 333 >AJ973476-1|CAJ01523.1| 126|Anopheles gambiae hypothetical protein protein. Length = 126 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -2 Query: 366 KVVTYLKDNFPSLWNSINRLYMPRGV 289 KV+ YL DN W ++ + Y P + Sbjct: 85 KVINYLIDNRKDQWENLQKKYDPENI 110 >AJ697729-1|CAG26922.1| 126|Anopheles gambiae putative sensory appendage protein SAP-3 protein. Length = 126 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -2 Query: 366 KVVTYLKDNFPSLWNSINRLYMPRGV 289 KV+ YL DN W ++ + Y P + Sbjct: 85 KVINYLIDNRKDQWENLQKKYDPENI 110 >AJ973475-1|CAJ01522.1| 127|Anopheles gambiae hypothetical protein protein. Length = 127 Score = 24.6 bits (51), Expect = 2.8 Identities = 8/30 (26%), Positives = 17/30 (56%) Frame = -2 Query: 378 SSMLKVVTYLKDNFPSLWNSINRLYMPRGV 289 S +KV+ Y+ +N W+++ + Y P + Sbjct: 81 SGAIKVINYVIENRKEQWDALQKKYDPENL 110 >AJ697728-1|CAG26921.1| 127|Anopheles gambiae putative sensory appendage protein SAP-2 protein. Length = 127 Score = 24.6 bits (51), Expect = 2.8 Identities = 8/30 (26%), Positives = 17/30 (56%) Frame = -2 Query: 378 SSMLKVVTYLKDNFPSLWNSINRLYMPRGV 289 S +KV+ Y+ +N W+++ + Y P + Sbjct: 81 SGAIKVINYVIENRKEQWDALQKKYDPENL 110 >AJ973471-1|CAJ01518.1| 122|Anopheles gambiae hypothetical protein protein. Length = 122 Score = 24.2 bits (50), Expect = 3.7 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = -2 Query: 378 SSMLKVVTYLKDNFPSLWNSINRLYMPRGV 289 +S KV+ +L++ P W + Y P G+ Sbjct: 81 TSSRKVIAHLEERKPQEWKKLLDKYDPEGI 110 >AJ697731-1|CAG26924.1| 122|Anopheles gambiae putative chemosensory protein CSP2 protein. Length = 122 Score = 24.2 bits (50), Expect = 3.7 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = -2 Query: 378 SSMLKVVTYLKDNFPSLWNSINRLYMPRGV 289 +S KV+ +L++ P W + Y P G+ Sbjct: 81 TSSRKVIAHLEERKPQEWKKLLDKYDPEGI 110 >AJ697730-1|CAG26923.1| 122|Anopheles gambiae putative chemosensory protein CSP1 protein. Length = 122 Score = 24.2 bits (50), Expect = 3.7 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = -2 Query: 378 SSMLKVVTYLKDNFPSLWNSINRLYMPRGV 289 +S KV+ +L++ P W + Y P G+ Sbjct: 81 TSSRKVIAHLEERKPQEWKKLLDKYDPEGI 110 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 24.2 bits (50), Expect = 3.7 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -2 Query: 357 TYLKDNFPSLWNSINRLYMPRGVPPVGRPS 268 T FPS+W + +P+ P G PS Sbjct: 500 TLTTGQFPSMWKIQKLVLIPKPGKPPGHPS 529 >Z49814-1|CAA89968.1| 137|Anopheles gambiae serine proteinase protein. Length = 137 Score = 23.8 bits (49), Expect = 4.8 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Frame = -3 Query: 317 STVCTCRGASHRWAGPAR---SVFRTRSELRDPLENESGGPV 201 +++C R ++R P R RSE D E +SGGP+ Sbjct: 5 ASICAKRIPTNRRQMPERLRDDQLCARSETMDTCEGDSGGPL 46 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 21.0 bits (42), Expect(2) = 5.1 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +3 Query: 372 WTSMWVFPV 398 W S W+FPV Sbjct: 526 WKSCWLFPV 534 Score = 20.6 bits (41), Expect(2) = 5.1 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +3 Query: 168 LIILEDASIVADWAARFVLQRITQFAPGPE 257 LI L D S+ ++ + + F PGP+ Sbjct: 462 LINLSDISVSSETVVQVLFGLKRSFTPGPD 491 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 23.4 bits (48), Expect = 6.4 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -3 Query: 287 HRWAGPARSVFRTRSELRDPLENESGGPVG 198 +RW G +FR EL P E G G Sbjct: 401 YRWHGMIDGIFRRHKELLTPYTAEQLGNPG 430 >AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein protein. Length = 429 Score = 23.0 bits (47), Expect = 8.4 Identities = 11/30 (36%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = +2 Query: 182 RCQHRCRLGRQIRSPADH---AVRSGSGRH 262 RC R + R+ RSP D +R G+ H Sbjct: 366 RCLERGHIARECRSPVDRQKACIRCGAEGH 395 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 713,275 Number of Sequences: 2352 Number of extensions: 14532 Number of successful extensions: 43 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -