BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0558 (725 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 23 3.9 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 23 3.9 L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. 21 9.0 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 22.6 bits (46), Expect = 3.9 Identities = 7/32 (21%), Positives = 17/32 (53%) Frame = +3 Query: 99 IHEYNRAQIVNDVFQFARSGLMTYNRAFNILS 194 + YN + VN+ Q + G++ + F +++ Sbjct: 68 LDNYNDKEAVNEFMQLLKHGMLPRGQVFTMMN 99 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 22.6 bits (46), Expect = 3.9 Identities = 7/32 (21%), Positives = 17/32 (53%) Frame = +3 Query: 99 IHEYNRAQIVNDVFQFARSGLMTYNRAFNILS 194 + YN + VN+ Q + G++ + F +++ Sbjct: 68 LDNYNDKEAVNEFMQLLKHGMLPRGQVFTMMN 99 >L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. Length = 150 Score = 21.4 bits (43), Expect = 9.0 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 260 NRLVGTAHLTTLNNLIARWSSNLMNQ 337 N +V HLT LNN I L N+ Sbjct: 91 NSVVYIEHLTKLNNAIEEKRFELTNR 116 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,643 Number of Sequences: 438 Number of extensions: 4018 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -