BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0552 (683 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0522 - 21726317-21726634,21727202-21727654,21727771-217280... 29 4.5 >06_03_0522 - 21726317-21726634,21727202-21727654,21727771-21728025, 21728109-21728249,21728404-21728565,21728660-21728820, 21731598-21731733 Length = 541 Score = 28.7 bits (61), Expect = 4.5 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 4/48 (8%) Frame = -3 Query: 402 TCNYCSFH--VTRFFFRMF--SSDSKCFRDIETEIVHNYGNYIYVFVK 271 T +YC FH V R+ +S K FRDI ++HN + + VK Sbjct: 129 TSDYCDFHKMVKRYVMSSMLGTSAQKQFRDIRDMMIHNMLSTFHKLVK 176 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,046,976 Number of Sequences: 37544 Number of extensions: 305251 Number of successful extensions: 445 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 437 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 445 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1733104716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -