BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0552 (683 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g01710.1 68418.m00088 expressed protein 27 8.8 At2g35510.1 68415.m04349 WWE domain-containing protein contains ... 27 8.8 >At5g01710.1 68418.m00088 expressed protein Length = 513 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -3 Query: 621 IFSVLQRAGVRHIETRDPQMPHGRELKFQRFLIRTDSGQTH 499 +F+ + +R I+ DP MPH RE Q++ D G H Sbjct: 213 LFNSCRLVKMRDIDGFDPSMPHIREFVIQKY-SEIDGGGHH 252 >At2g35510.1 68415.m04349 WWE domain-containing protein contains Pfam domain, PF02825: WWE domain Length = 568 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 618 FSVLQRAGVRHIETRDPQMPHGRELKFQRFLIRTDSGQ 505 F L+R G HI DP+ RE+K I +SG+ Sbjct: 165 FDTLERDGCHHIRGEDPEQHDQREIKL-HIEIDVNSGE 201 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,901,487 Number of Sequences: 28952 Number of extensions: 278383 Number of successful extensions: 477 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 477 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -