BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0550 (403 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g24360.1 68418.m02872 protein kinase family protein / Ire1 ho... 27 3.5 At3g02670.1 68416.m00258 proline-rich family protein contains pr... 26 8.2 >At5g24360.1 68418.m02872 protein kinase family protein / Ire1 homolog-1 (IRE1-1) identical to Ire1 homolog-1 [Arabidopsis thaliana] GI:15277137; cDNA Ire1 homolog-1 GI:15277136; Length = 881 Score = 27.5 bits (58), Expect = 3.5 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -3 Query: 296 KSSKLLE*LRFLLNTKICHLGRVTEISKFY 207 + S LL+ + FLL + + H + +EISKFY Sbjct: 2 RGSALLDLILFLLVSPLAHSFKGSEISKFY 31 >At3g02670.1 68416.m00258 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 217 Score = 26.2 bits (55), Expect = 8.2 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 14 LSPKRAKPYDRLCYSTDNETFNTYFFETPY 103 L+ AKP DR+ +T NE N F P+ Sbjct: 28 LNDADAKPVDRVVTTTTNEANNLAFVSDPF 57 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,718,221 Number of Sequences: 28952 Number of extensions: 152858 Number of successful extensions: 380 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 374 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 380 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 585758608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -