BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0545 (693 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23D3.13c |||guanyl-nucleotide exchange factor|Schizosaccharo... 28 1.1 SPAC16E8.11c |tfb1||transcription factor TFIIH complex subunit T... 28 1.5 >SPAC23D3.13c |||guanyl-nucleotide exchange factor|Schizosaccharomyces pombe|chr 1|||Manual Length = 1616 Score = 28.3 bits (60), Expect = 1.1 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = -3 Query: 382 WHVLLVRCSHPCRNSPQRIRDG*QQSEHKIFHRAHCDGKIQRYATVCRIVEFSL 221 W +LLV + C NS +R+G Q +IF+ +A+ C++V L Sbjct: 1024 WIMLLVHLADLCENSWASVRNGAAQILFRIFNSQCSKLGTNAWASCCQLVIMKL 1077 >SPAC16E8.11c |tfb1||transcription factor TFIIH complex subunit Tfb1|Schizosaccharomyces pombe|chr 1|||Manual Length = 477 Score = 27.9 bits (59), Expect = 1.5 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 443 RVFLLICSDGELPFKAAVYLTAPPQARTHCD 535 RVF+++ +GE P + T P AR +CD Sbjct: 3 RVFIVV-KEGEDPTSLVFHFTGTPNARENCD 32 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,047,577 Number of Sequences: 5004 Number of extensions: 66657 Number of successful extensions: 199 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 192 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 199 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 321951680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -