BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0541 (686 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 27 0.55 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 27 0.55 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 27 0.55 AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhi... 24 3.9 AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox prote... 24 3.9 AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 24 3.9 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 24 5.2 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 24 5.2 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 24 5.2 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 24 5.2 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 24 5.2 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 24 5.2 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 24 5.2 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 24 5.2 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 24 5.2 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 24 5.2 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 24 5.2 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 24 5.2 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 24 5.2 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 24 5.2 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 9.0 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 27.1 bits (57), Expect = 0.55 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 21 LDGGERRR*AGASETNQETRQGTCREP 101 L GGER+R A ASET + C EP Sbjct: 244 LSGGERKRLAFASETLTDPHLLLCDEP 270 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 27.1 bits (57), Expect = 0.55 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 21 LDGGERRR*AGASETNQETRQGTCREP 101 L GGER+R A ASET + C EP Sbjct: 244 LSGGERKRLAFASETLTDPHLLLCDEP 270 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 27.1 bits (57), Expect = 0.55 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 21 LDGGERRR*AGASETNQETRQGTCREP 101 L GGER+R A ASET + C EP Sbjct: 222 LSGGERKRLAFASETLTDPHLLLCDEP 248 >AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhibitor protein protein. Length = 335 Score = 24.2 bits (50), Expect = 3.9 Identities = 9/42 (21%), Positives = 23/42 (54%) Frame = -3 Query: 258 ILITVTISRLSYCEIHFSREKTGKSAPESLLYKAPVNSNCIT 133 + + VT+S L +CE +++ K+ L ++ + +C++ Sbjct: 7 LFVIVTLSCLYFCEAQTDKKQCAKNNEYCLTHRDCCSGSCLS 48 >AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox protein protein. Length = 338 Score = 24.2 bits (50), Expect = 3.9 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -1 Query: 209 SQERKQENQHQNHCCIK 159 S + +Q+ QH HCC + Sbjct: 275 SPKEQQQQQHGQHCCCR 291 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 24.2 bits (50), Expect = 3.9 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -2 Query: 670 LKTLCTNILLAGMRLTFNFITITYNHWMNIECLNLP 563 L TL ++L+A + F+ YN+W N + LP Sbjct: 3 LLTLTLSLLVALATGLYLFVRNRYNYWSNRQFPTLP 38 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 376 FAIRLYQNHGAADSIGNKT 432 FA++ Y + G D +GN T Sbjct: 128 FAVKFYTDDGVWDMVGNNT 146 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 376 FAIRLYQNHGAADSIGNKT 432 FA++ Y + G D +GN T Sbjct: 128 FAVKFYTDDGVWDMVGNNT 146 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 376 FAIRLYQNHGAADSIGNKT 432 FA++ Y + G D +GN T Sbjct: 128 FAVKFYTDDGVWDMVGNNT 146 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 376 FAIRLYQNHGAADSIGNKT 432 FA++ Y + G D +GN T Sbjct: 128 FAVKFYTDDGVWDMVGNNT 146 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 376 FAIRLYQNHGAADSIGNKT 432 FA++ Y + G D +GN T Sbjct: 128 FAVKFYTDDGVWDMVGNNT 146 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 376 FAIRLYQNHGAADSIGNKT 432 FA++ Y + G D +GN T Sbjct: 128 FAVKFYTDDGVWDMVGNNT 146 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 376 FAIRLYQNHGAADSIGNKT 432 FA++ Y + G D +GN T Sbjct: 128 FAVKFYTDDGVWDMVGNNT 146 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 376 FAIRLYQNHGAADSIGNKT 432 FA++ Y + G D +GN T Sbjct: 128 FAVKFYTDDGVWDMVGNNT 146 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 376 FAIRLYQNHGAADSIGNKT 432 FA++ Y + G D +GN T Sbjct: 128 FAVKFYTDDGVWDMVGNNT 146 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 376 FAIRLYQNHGAADSIGNKT 432 FA++ Y + G D +GN T Sbjct: 128 FAVKFYTDDGVWDMVGNNT 146 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 376 FAIRLYQNHGAADSIGNKT 432 FA++ Y + G D +GN T Sbjct: 128 FAVKFYTDDGVWDMVGNNT 146 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 376 FAIRLYQNHGAADSIGNKT 432 FA++ Y + G D +GN T Sbjct: 128 FAVKFYTDDGVWDMVGNNT 146 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.8 bits (49), Expect = 5.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 376 FAIRLYQNHGAADSIGNKT 432 FA++ Y + G D +GN T Sbjct: 128 FAVKFYTDDGVWDMVGNNT 146 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 23.8 bits (49), Expect = 5.2 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 376 FAIRLYQNHGAADSIGNKT 432 FA++ Y + G D +GN T Sbjct: 112 FAVKFYTDDGVWDMVGNNT 130 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.0 bits (47), Expect = 9.0 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = -1 Query: 206 QERKQENQHQNHCCIKLR*TRTALQLNSYCCLHSAGFSAGPLPGFL 69 Q+++Q+ QHQ H +L+ QL S HS+ GP P + Sbjct: 1314 QQQQQQQQHQQHQQHQLQ-HHHQPQL-SQSSHHSSSSHGGPTPSII 1357 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 643,613 Number of Sequences: 2352 Number of extensions: 12156 Number of successful extensions: 42 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -