BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0541 (686 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g63810.1 68418.m08008 beta-galactosidase, putative / lactase,... 28 6.7 At1g78660.3 68414.m09168 gamma-glutamyl hydrolase, putative / ga... 28 6.7 At1g78660.2 68414.m09169 gamma-glutamyl hydrolase, putative / ga... 28 6.7 At1g78660.1 68414.m09167 gamma-glutamyl hydrolase, putative / ga... 28 6.7 >At5g63810.1 68418.m08008 beta-galactosidase, putative / lactase, putative similar to beta-galactosidase GI:7939621 from [Lycopersicon esculentum]; contains Pfam profile PF01301: Glycosyl hydrolases family 35 Length = 741 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 283 FFSKNILVHTYYCYHQSTKLLRNS 212 FF K VH YY YH T R S Sbjct: 285 FFGKGGSVHNYYMYHGGTNFGRTS 308 >At1g78660.3 68414.m09168 gamma-glutamyl hydrolase, putative / gamma-Glu-X carboxypeptidase, putative / conjugase, putative similar to SP|O65355 Gamma-glutamyl hydrolase precursor (EC 3.4.19.9) (Gamma-Glu-X carboxypeptidase) (Conjugase) (GH) {Arabidopsis thaliana} Length = 348 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 110 ANSSSYLIVMQFEFTGALYNNDSGADFPVFSL 205 A Y +++ FT AL ND+G FPV+ + Sbjct: 124 AKKYDYFEIVKKIFTKALERNDAGEHFPVYGI 155 >At1g78660.2 68414.m09169 gamma-glutamyl hydrolase, putative / gamma-Glu-X carboxypeptidase, putative / conjugase, putative similar to SP|O65355 Gamma-glutamyl hydrolase precursor (EC 3.4.19.9) (Gamma-Glu-X carboxypeptidase) (Conjugase) (GH) {Arabidopsis thaliana} Length = 347 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 110 ANSSSYLIVMQFEFTGALYNNDSGADFPVFSL 205 A Y +++ FT AL ND+G FPV+ + Sbjct: 123 AKKYDYFEIVKKIFTKALERNDAGEHFPVYGI 154 >At1g78660.1 68414.m09167 gamma-glutamyl hydrolase, putative / gamma-Glu-X carboxypeptidase, putative / conjugase, putative similar to SP|O65355 Gamma-glutamyl hydrolase precursor (EC 3.4.19.9) (Gamma-Glu-X carboxypeptidase) (Conjugase) (GH) {Arabidopsis thaliana} Length = 348 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 110 ANSSSYLIVMQFEFTGALYNNDSGADFPVFSL 205 A Y +++ FT AL ND+G FPV+ + Sbjct: 124 AKKYDYFEIVKKIFTKALERNDAGEHFPVYGI 155 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,017,953 Number of Sequences: 28952 Number of extensions: 243996 Number of successful extensions: 517 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 517 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -