BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0540 (724 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0076 + 8164466-8164511,8164643-8164698,8165529-8165867,816... 28 6.5 >05_03_0076 + 8164466-8164511,8164643-8164698,8165529-8165867, 8165938-8166012,8166674-8166846,8168697-8168795, 8169002-8169161,8169321-8169464,8169551-8169723, 8169796-8169991,8170061-8170258,8170864-8171016, 8171838-8171959,8172037-8172136,8172221-8172316, 8172400-8172530,8173717-8173819,8174373-8174555, 8174632-8174724,8174818-8174853,8175672-8175773, 8176310-8176472,8176557-8176678,8176994-8177158, 8177667-8177849,8178679-8178831,8179136-8179288, 8179373-8179444,8179530-8179664,8179739-8179800, 8179999-8180096,8180628-8180737,8180832-8181005, 8181092-8181157,8181847-8181915,8181989-8182099, 8182418-8182558,8182638-8182766,8182864-8183029, 8183174-8183388,8184883-8185089,8185501-8185572, 8185897-8186010,8186090-8186281,8186489-8186569, 8186654-8186728,8186812-8186878,8187292-8187452, 8187943-8188116,8188209-8188337,8188421-8188504, 8188589-8188650,8188728-8188800,8189008-8189142, 8189790-8189960,8190054-8190319,8190440-8190458 Length = 2448 Score = 28.3 bits (60), Expect = 6.5 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 5/61 (8%) Frame = +3 Query: 468 RGRPTLPGRYV--AVTRNIWAV---SSTSHVPCTLSI*LRFLIRQFNYSRLGGIETKVK* 632 RGRP + G+YV AVT +++ S+T V +L LR L FN+ ++ ++ Sbjct: 1720 RGRPDIAGKYVVAAVTGYFYSIACASTTKGVDDSLQDILRLLTLWFNHGATSEVQMALQK 1779 Query: 633 G 635 G Sbjct: 1780 G 1780 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,056,011 Number of Sequences: 37544 Number of extensions: 330578 Number of successful extensions: 614 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 614 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1886372480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -