BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0529 (513 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 26 0.65 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 25 1.1 Y17700-1|CAA76820.1| 122|Anopheles gambiae hypothetical protein... 24 3.5 AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 pr... 24 3.5 AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 pr... 24 3.5 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 23 6.1 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 23 6.1 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 26.2 bits (55), Expect = 0.65 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = -3 Query: 205 GSERPQDAAENADFSFSGTD*C*NSGN 125 GSE+P++A E + + SGTD +SG+ Sbjct: 1348 GSEKPKNAIEPSQEAVSGTDNANDSGD 1374 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 25.4 bits (53), Expect = 1.1 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 402 LRSRGQPCSGVRRPTRHQQITVNYSNDTCESK 497 L + P G RRPT++QQI +++D E++ Sbjct: 16 LANEFNPNRGRRRPTKNQQIYGVWADDDSENE 47 >Y17700-1|CAA76820.1| 122|Anopheles gambiae hypothetical protein protein. Length = 122 Score = 23.8 bits (49), Expect = 3.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +1 Query: 361 VNNFLEKIPVYLTDYAAEVS 420 VN EK+P YL++ +A V+ Sbjct: 88 VNAIYEKLPAYLSEVSARVN 107 >AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 23.8 bits (49), Expect = 3.5 Identities = 18/63 (28%), Positives = 31/63 (49%) Frame = -1 Query: 447 ELGDVLQNTADLGCVVRQVDRDLL*EVVDGWSNFASEEIDLEVRFDIANSYCSSDVTDND 268 +LGD +N D+G R DL+ E + +N + EEI EV + + ++ + Sbjct: 1 DLGDNDEN--DIGEKRRLAFLDLMIETANNGANISDEEIKEEVDTIMFEGHDTTAAGSSF 58 Query: 267 VVC 259 V+C Sbjct: 59 VLC 61 >AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 23.8 bits (49), Expect = 3.5 Identities = 18/63 (28%), Positives = 31/63 (49%) Frame = -1 Query: 447 ELGDVLQNTADLGCVVRQVDRDLL*EVVDGWSNFASEEIDLEVRFDIANSYCSSDVTDND 268 +LGD +N D+G R DL+ E + +N + EEI EV + + ++ + Sbjct: 1 DLGDNDEN--DIGEKRRLAFLDLMIETANNGANISDEEIKEEVDTIMFEGHDTTAAGSSF 58 Query: 267 VVC 259 V+C Sbjct: 59 VLC 61 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.0 bits (47), Expect = 6.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 81 RKCRELKSSALTSVTRPEK 25 R C ELKSS + +TR E+ Sbjct: 760 RMCWELKSSTIVMMTRLEE 778 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.0 bits (47), Expect = 6.1 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -3 Query: 247 SGSLSNDVLKGKSSGSERPQDAAENADFSFSGTD 146 S ++ ND +K +SGS + Q E F F D Sbjct: 1270 SVTIKNDPMK--TSGSTQQQQQMERQQFGFGNND 1301 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 444,758 Number of Sequences: 2352 Number of extensions: 8446 Number of successful extensions: 63 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 62 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46514490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -