BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0529 (513 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK092754-1|BAC03965.1| 615|Homo sapiens protein ( Homo sapiens ... 31 3.1 AK092650-1|BAC03936.1| 577|Homo sapiens protein ( Homo sapiens ... 30 4.1 >AK092754-1|BAC03965.1| 615|Homo sapiens protein ( Homo sapiens cDNA FLJ35435 fis, clone SMINT2002620. ). Length = 615 Score = 30.7 bits (66), Expect = 3.1 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = -1 Query: 246 AVASATTFSRASPPEAKDLRTRLKMRISP---SAEPTDAETLGTARTKLSRVP 97 A ++F R S DLRT R+ S+ TD++ LG+ RTK R P Sbjct: 259 AFLKKSSFKRKSTSNLADLRTAHDARVPQRTLSSSSTDSQKLGSGRTKRWRSP 311 >AK092650-1|BAC03936.1| 577|Homo sapiens protein ( Homo sapiens cDNA FLJ35331 fis, clone PROST2014659. ). Length = 577 Score = 30.3 bits (65), Expect = 4.1 Identities = 21/59 (35%), Positives = 28/59 (47%) Frame = -1 Query: 306 ANSYCSSDVTDNDVVCEETEAVASATTFSRASPPEAKDLRTRLKMRISPSAEPTDAETL 130 A SY SS +C+ V+ T S +SPP+A LR L + S+ P DA L Sbjct: 112 ARSYSSSPPDPTPPLCQILLLVS--TRCSSSSPPDAPRLREMLLLSARCSSSPPDAPPL 168 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 62,076,244 Number of Sequences: 237096 Number of extensions: 1080501 Number of successful extensions: 3042 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2952 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3042 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4820001670 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -