BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0523 (690 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 23 3.1 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 22 5.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.5 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 9.5 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 22.6 bits (46), Expect = 3.1 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -1 Query: 321 PRYGETIEVQTKLLHDFHVP 262 P E ++V + +DFH+P Sbjct: 190 PGMSENVDVINLMTYDFHIP 209 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 21.8 bits (44), Expect = 5.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -2 Query: 578 GLIYRDPKFHPISKILEQNLSVVSNQSTIIG 486 G+ Y+D + +S + Q+ +N TI+G Sbjct: 371 GINYKDTNDNNVSAVTTQHQGYPTNTVTILG 401 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 9.5 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -2 Query: 182 HPISTNSFHPHPTLLLPDK 126 HP ++++ P T ++PDK Sbjct: 2285 HPDASSTMAPSTTPMVPDK 2303 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.0 bits (42), Expect = 9.5 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 504 PIYDHRVGPAPQILEALGQIPMV 436 P++DHR A Q A Q+P + Sbjct: 302 PLHDHRPALAQQRRVAAVQVPQL 324 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,381 Number of Sequences: 336 Number of extensions: 4324 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -