BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0521 (665 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR542144-1|CAG46941.1| 82|Homo sapiens P8 protein. 56 9e-08 BT006896-1|AAP35542.1| 82|Homo sapiens p8 protein (candidate o... 56 9e-08 BC002434-1|AAH02434.1| 82|Homo sapiens nuclear protein 1 protein. 56 9e-08 AF135266-1|AAD49221.1| 82|Homo sapiens p8 protein homolog prot... 56 9e-08 AF069074-1|AAC19385.1| 82|Homo sapiens P8 protein protein. 56 9e-08 AF069073-1|AAC19384.1| 82|Homo sapiens P8 protein protein. 56 9e-08 AC002425-2|AAC05336.1| 82|Homo sapiens Gene product with simil... 56 9e-08 AC002425-1|AAC05335.1| 100|Homo sapiens Gene product with simil... 50 6e-06 >CR542144-1|CAG46941.1| 82|Homo sapiens P8 protein. Length = 82 Score = 56.4 bits (130), Expect = 9e-08 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 1/69 (1%) Frame = +2 Query: 62 QMPNVNMSEAFFDEYDYYNFDHDKHIFTGHGGKQ-RTKKEASEHTNHFDPSGHSRKIVTK 238 Q P ++ DE D Y+ H + G GG++ RTK+EA+ +TN P GH RK+VTK Sbjct: 13 QPPGPEDEDSSLDESDLYSLAHS---YLGGGGRKGRTKREAAANTNRPSPGGHERKLVTK 69 Query: 239 LMNAEPTRR 265 L N+E +R Sbjct: 70 LQNSERKKR 78 >BT006896-1|AAP35542.1| 82|Homo sapiens p8 protein (candidate of metastasis 1) protein. Length = 82 Score = 56.4 bits (130), Expect = 9e-08 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 1/69 (1%) Frame = +2 Query: 62 QMPNVNMSEAFFDEYDYYNFDHDKHIFTGHGGKQ-RTKKEASEHTNHFDPSGHSRKIVTK 238 Q P ++ DE D Y+ H + G GG++ RTK+EA+ +TN P GH RK+VTK Sbjct: 13 QPPGPEDEDSSLDESDLYSLAHS---YLGGGGRKGRTKREAAANTNRPSPGGHERKLVTK 69 Query: 239 LMNAEPTRR 265 L N+E +R Sbjct: 70 LQNSERKKR 78 >BC002434-1|AAH02434.1| 82|Homo sapiens nuclear protein 1 protein. Length = 82 Score = 56.4 bits (130), Expect = 9e-08 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 1/69 (1%) Frame = +2 Query: 62 QMPNVNMSEAFFDEYDYYNFDHDKHIFTGHGGKQ-RTKKEASEHTNHFDPSGHSRKIVTK 238 Q P ++ DE D Y+ H + G GG++ RTK+EA+ +TN P GH RK+VTK Sbjct: 13 QPPGPEDEDSSLDESDLYSLAHS---YLGGGGRKGRTKREAAANTNRPSPGGHERKLVTK 69 Query: 239 LMNAEPTRR 265 L N+E +R Sbjct: 70 LQNSERKKR 78 >AF135266-1|AAD49221.1| 82|Homo sapiens p8 protein homolog protein. Length = 82 Score = 56.4 bits (130), Expect = 9e-08 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 1/69 (1%) Frame = +2 Query: 62 QMPNVNMSEAFFDEYDYYNFDHDKHIFTGHGGKQ-RTKKEASEHTNHFDPSGHSRKIVTK 238 Q P ++ DE D Y+ H + G GG++ RTK+EA+ +TN P GH RK+VTK Sbjct: 13 QPPGPEDEDSSLDESDLYSLAHS---YLGGGGRKGRTKREAAANTNRPSPGGHERKLVTK 69 Query: 239 LMNAEPTRR 265 L N+E +R Sbjct: 70 LQNSERKKR 78 >AF069074-1|AAC19385.1| 82|Homo sapiens P8 protein protein. Length = 82 Score = 56.4 bits (130), Expect = 9e-08 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 1/69 (1%) Frame = +2 Query: 62 QMPNVNMSEAFFDEYDYYNFDHDKHIFTGHGGKQ-RTKKEASEHTNHFDPSGHSRKIVTK 238 Q P ++ DE D Y+ H + G GG++ RTK+EA+ +TN P GH RK+VTK Sbjct: 13 QPPGPEDEDSSLDESDLYSLAHS---YLGGGGRKGRTKREAAANTNRPSPGGHERKLVTK 69 Query: 239 LMNAEPTRR 265 L N+E +R Sbjct: 70 LQNSERKKR 78 >AF069073-1|AAC19384.1| 82|Homo sapiens P8 protein protein. Length = 82 Score = 56.4 bits (130), Expect = 9e-08 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 1/69 (1%) Frame = +2 Query: 62 QMPNVNMSEAFFDEYDYYNFDHDKHIFTGHGGKQ-RTKKEASEHTNHFDPSGHSRKIVTK 238 Q P ++ DE D Y+ H + G GG++ RTK+EA+ +TN P GH RK+VTK Sbjct: 13 QPPGPEDEDSSLDESDLYSLAHS---YLGGGGRKGRTKREAAANTNRPSPGGHERKLVTK 69 Query: 239 LMNAEPTRR 265 L N+E +R Sbjct: 70 LQNSERKKR 78 >AC002425-2|AAC05336.1| 82|Homo sapiens Gene product with similarity to Rat P8 protein. Length = 82 Score = 56.4 bits (130), Expect = 9e-08 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 1/69 (1%) Frame = +2 Query: 62 QMPNVNMSEAFFDEYDYYNFDHDKHIFTGHGGKQ-RTKKEASEHTNHFDPSGHSRKIVTK 238 Q P ++ DE D Y+ H + G GG++ RTK+EA+ +TN P GH RK+VTK Sbjct: 13 QPPGPEDEDSSLDESDLYSLAHS---YLGGGGRKGRTKREAAANTNRPSPGGHERKLVTK 69 Query: 239 LMNAEPTRR 265 L N+E +R Sbjct: 70 LQNSERKKR 78 >AC002425-1|AAC05335.1| 100|Homo sapiens Gene product with similarity to Rat P8 protein. Length = 100 Score = 50.4 bits (115), Expect = 6e-06 Identities = 23/44 (52%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = +2 Query: 137 IFTGHGGKQ-RTKKEASEHTNHFDPSGHSRKIVTKLMNAEPTRR 265 + TG GG++ RTK+EA+ +TN P GH RK+VTKL N+E +R Sbjct: 53 LVTGGGGRKGRTKREAAANTNRPSPGGHERKLVTKLQNSERKKR 96 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,729,495 Number of Sequences: 237096 Number of extensions: 2007788 Number of successful extensions: 7754 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 7573 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7746 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7535049140 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -