BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0520 (687 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1565.02c |||GTPase activating protein|Schizosaccharomyces po... 25 7.8 SPAC20G4.08 ||SPAC4F10.01|sequence orphan|Schizosaccharomyces po... 25 7.8 >SPAC1565.02c |||GTPase activating protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 374 Score = 25.4 bits (53), Expect = 7.8 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 503 IYYIHTKWLKKIYILTFEKKAS 568 +Y IHT W+ K+ I T AS Sbjct: 94 VYVIHTDWMSKVAIRTLLSIAS 115 >SPAC20G4.08 ||SPAC4F10.01|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 1076 Score = 25.4 bits (53), Expect = 7.8 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 482 ANAKYSFRYVPAAFKTNRLEYRSLNETIST 393 A +YS + V A K + ++Y LNE + T Sbjct: 839 AQLRYSIQNVAHAQKESEVKYNELNEQVKT 868 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,472,855 Number of Sequences: 5004 Number of extensions: 47051 Number of successful extensions: 106 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 106 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -