BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0517 (762 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 23 2.0 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 6.1 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 23.4 bits (48), Expect = 2.0 Identities = 7/34 (20%), Positives = 17/34 (50%) Frame = -2 Query: 272 HFLKTRFNNRVDRRRSSATVTVYYYDNIPIIVKG 171 HF +T ++ +VD + + + P +++G Sbjct: 441 HFCRTMYSMKVDNAEYALLTAIVIFSERPALIEG 474 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 6.1 Identities = 7/23 (30%), Positives = 12/23 (52%) Frame = +1 Query: 508 CDWENNVLRLGTNDAQYVEVIHT 576 CDW GT++ V+++ T Sbjct: 1320 CDWPEKATCDGTSNVNVVDIVTT 1342 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,205 Number of Sequences: 336 Number of extensions: 4181 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20442493 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -