BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0517 (762 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22H12.03 |||mitochondrial hydrolase|Schizosaccharomyces pomb... 27 2.2 SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharo... 27 2.9 SPBC23E6.01c ||SPBPJ758.01|RNA-binding protein, rrm type|Schizos... 26 5.1 SPAC24C9.15c |spn5|mde9, meu28|septin Spn5|Schizosaccharomyces p... 25 8.9 >SPAC22H12.03 |||mitochondrial hydrolase|Schizosaccharomyces pombe|chr 1|||Manual Length = 270 Score = 27.5 bits (58), Expect = 2.2 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = +2 Query: 374 FLKNLKLPLNKVHIVGFNLGAHVAGVTGRNLEGKVARITGLDPS 505 F+K+ KL +K I+G ++GA A VT KV ++ +D S Sbjct: 80 FMKDHKL--DKASIIGHSMGAKTAMVTALKWPDKVEKLVVVDNS 121 >SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 1811 Score = 27.1 bits (57), Expect = 2.9 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 99 YSNAQRNPITLTEDHFPTGNDPAAPFNNN 185 Y Q+N I L ++ PT N P P +N Sbjct: 874 YEEIQKNEIVLKDEQDPTSNFPEIPGTSN 902 >SPBC23E6.01c ||SPBPJ758.01|RNA-binding protein, rrm type|Schizosaccharomyces pombe|chr 2|||Manual Length = 473 Score = 26.2 bits (55), Expect = 5.1 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -1 Query: 636 KEVNVSNSNAQAVFVDTRSVGVNNFNVLSIVCSQ 535 +E ++S ++ ++FV S VN F+V S+ S+ Sbjct: 176 REKSISKASEYSIFVGDLSPNVNEFDVYSLFASR 209 >SPAC24C9.15c |spn5|mde9, meu28|septin Spn5|Schizosaccharomyces pombe|chr 1|||Manual Length = 464 Score = 25.4 bits (53), Expect = 8.9 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = -1 Query: 654 DKTAVDKEVNVSNSNAQAV--FVDTRSVGVNNFN 559 DK K+ V NSN +++ F ++G+N+FN Sbjct: 72 DKKTEFKQDEVPNSNGKSIPTFHPCNNIGINDFN 105 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,178,403 Number of Sequences: 5004 Number of extensions: 67604 Number of successful extensions: 201 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 189 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 201 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 365309308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -