BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0514 (468 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g07730.2 68414.m00834 disease resistance-responsive family pr... 34 0.055 At4g34300.1 68417.m04875 glycine-rich protein similar to auxin r... 33 0.096 At3g18810.1 68416.m02389 protein kinase family protein contains ... 32 0.17 At5g62940.1 68418.m07897 Dof-type zinc finger domain-containing ... 30 0.68 At3g28780.1 68416.m03592 glycine-rich protein similar to H41 gen... 30 0.90 At5g50920.1 68418.m06315 ATP-dependent Clp protease ATP-binding ... 29 2.1 At3g29080.1 68416.m03641 hypothetical protein 29 2.1 At5g15250.1 68418.m01786 FtsH protease, putative similar to FtsH... 28 2.7 At3g48870.1 68416.m05338 ATP-dependent Clp protease ATP-binding ... 28 3.6 At2g43010.2 68415.m05338 phytochrome-interacting factor 4 (PIF4)... 28 3.6 At2g43010.1 68415.m05337 phytochrome-interacting factor 4 (PIF4)... 28 3.6 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 28 3.6 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 28 3.6 At3g52120.1 68416.m05721 SWAP (Suppressor-of-White-APricot)/surp... 27 4.8 At5g14690.1 68418.m01721 expressed protein predicted protein, Ar... 27 6.3 At2g25980.1 68415.m03120 jacalin lectin family protein similar t... 27 6.3 At5g16780.1 68418.m01965 SART-1 family protein contains Pfam dom... 27 8.4 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 27 8.4 At2g01760.1 68415.m00106 two-component responsive regulator fami... 27 8.4 At1g70740.1 68414.m08154 protein kinase family protein contains ... 27 8.4 At1g47320.1 68414.m05239 expressed protein similar to putative n... 27 8.4 At1g27950.1 68414.m03424 lipid transfer protein-related low simi... 27 8.4 >At1g07730.2 68414.m00834 disease resistance-responsive family protein contains Pfam PF03018: Plant disease resistance response protein Length = 389 Score = 33.9 bits (74), Expect = 0.055 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 6/78 (7%) Frame = -2 Query: 254 ATGARGGLSTIAGPTEIGTNSSTMAGLTEIGSNSLTMAGPTEMGSNSSMMAGPTAIGTKS 75 A+G G L T GP + T S++ L S +L + GP + ++S ++ G ++ Sbjct: 70 ASGGLGSLGTNTGPGPLSTTGSSL--LPVASSGTLPVTGPGPLPTSSGLLPGASSGNLPG 127 Query: 74 S------MMGAGAATPGL 39 S +G+GAA GL Sbjct: 128 SGSGPLPTVGSGAAATGL 145 >At4g34300.1 68417.m04875 glycine-rich protein similar to auxin response factor 30 (GI:20145855) {Arabidopsis thaliana} Length = 313 Score = 33.1 bits (72), Expect = 0.096 Identities = 43/153 (28%), Positives = 63/153 (41%), Gaps = 23/153 (15%) Frame = -2 Query: 458 GSNG----SNVSNLDRLGDGSIDNNHGLSYDFGFVNDNHGL-WDNGIDTGSGDNRGRASL 294 GSNG S+ + GS N+ G S+ +G+ +D W G +GS + G S Sbjct: 37 GSNGDWGWSSGGSFGSGSGGSDSNSGGSSWGWGWSSDGTDTNWGWGSSSGSNHSSGTGST 96 Query: 293 VDVQNDLHERSAVATGARGGLST------IAGPTE----IGTNSSTMAGLTE----IGSN 156 + + S+ G S+ G T G+N S++ G T GSN Sbjct: 97 HNGHSSGSNHSSGTGSTHNGHSSGSNHSSSTGSTHNNHSSGSNHSSIVGSTHKNHGSGSN 156 Query: 155 SLTMAGPT----EMGSNSSMMAGPTAIGTKSSM 69 ++AGPT GSN S + G T T S+ Sbjct: 157 HSSIAGPTHNGHSSGSNHSSIIGSTHNHTAPSL 189 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 32.3 bits (70), Expect = 0.17 Identities = 26/103 (25%), Positives = 47/103 (45%), Gaps = 4/103 (3%) Frame = -2 Query: 452 NGSNVSNLDRLGDGSIDNNHGLSYD-FGFVNDNHGLWDNGIDTGSGDNRGRASLVDVQND 276 N +N +N + G+ + DNN+G + D N+N+G +NG D +N G + + QN+ Sbjct: 79 NNNNDNNNNNNGNNNNDNNNGNNKDNNNNGNNNNGNNNNGNDNNGNNNNGNNNDNNNQNN 138 Query: 275 ---LHERSAVATGARGGLSTIAGPTEIGTNSSTMAGLTEIGSN 156 + RS ++ + P + S+ G G+N Sbjct: 139 GGGSNNRSPPPPSRNSDRNSPSPPRALAPPRSSGGGSNSSGNN 181 >At5g62940.1 68418.m07897 Dof-type zinc finger domain-containing protein Dof zinc finger protein, Oryza sativa, EMBL:AB028129 Length = 372 Score = 30.3 bits (65), Expect = 0.68 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Frame = -2 Query: 461 LGSNGSNVSNLDRLGDGSIDNNH----GLSYDFGFVNDNHGLWDNGIDTGSGDNRGRASL 294 +G N N+ ++ +G ++H GL++ G N+N+ NGI TG N G L Sbjct: 217 MGVNNDNLVMVNHGSNGDHHHHHNHHMGLNHGVGLNNNNNNGGFNGISTGGNGNGG--GL 274 Query: 293 VDV 285 +D+ Sbjct: 275 MDI 277 >At3g28780.1 68416.m03592 glycine-rich protein similar to H41 gene for histone protein GB:X15142 GI:3204 [Physarum polycephalum] Length = 614 Score = 29.9 bits (64), Expect = 0.90 Identities = 25/87 (28%), Positives = 32/87 (36%) Frame = -2 Query: 263 SAVATGARGGLSTIAGPTEIGTNSSTMAGLTEIGSNSLTMAGPTEMGSNSSMMAGPTAIG 84 S VA+G G + + G ++ G GS T AG SSM G A G Sbjct: 444 SGVASGGSTGSESASAGAASGGSTEANGGAAAGGS---TEAGSGTSTETSSMGGGSAAAG 500 Query: 83 TKSSMMGAGAATPGLTRPLVGPATATA 3 S G+ G T +ATA Sbjct: 501 GVSESSSGGSTAAGGTSESASGGSATA 527 >At5g50920.1 68418.m06315 ATP-dependent Clp protease ATP-binding subunit / ClpC almost identical to ClpC GI:2921158 from [Arabidopsis thaliana]; contains Pfam profile PF02861: Clp amino terminal domain; contains Pfam profile PF00004: ATPase, AAA family; contains Pfam profile PF02151: UvrB/uvrC motif Length = 929 Score = 28.7 bits (61), Expect = 2.1 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 94 VGPAIIDEFEP-ISVGPAIVNEFEPISVRPAIVDEFVPISVG 216 +G +DE+ I PA+ F+P+ V VDE + I G Sbjct: 406 IGATTLDEYRKHIEKDPALERRFQPVKVPEPTVDETIQILKG 447 >At3g29080.1 68416.m03641 hypothetical protein Length = 445 Score = 28.7 bits (61), Expect = 2.1 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -2 Query: 227 TIAGPTEIGTNSSTMAGLTEIGSNSLTMAGPTEMGSNS 114 T +G TEIG ++ ++ +GS + T PT GS + Sbjct: 321 TASGQTEIGVSTRCISTSVVVGSEATTNTEPTTTGSRT 358 >At5g15250.1 68418.m01786 FtsH protease, putative similar to FtsH-like protein Pftf precursor GI:4325041 from [Nicotiana tabacum] Length = 687 Score = 28.3 bits (60), Expect = 2.7 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = -2 Query: 257 VATGARGGLSTIAGPTEIGTNSSTMAGLTEIGSNSLT 147 + TGA G L + TEI TM G++EIG +LT Sbjct: 555 ITTGAAGDLQQV---TEIARQMVTMFGMSEIGPWALT 588 >At3g48870.1 68416.m05338 ATP-dependent Clp protease ATP-binding subunit (ClpC) identical to AtClpC GI:5360574 from [Arabidopsis thaliana]; contains Pfam profiles PF02861: Clp amino terminal domain and PF02151: UvrB/uvrC motif Length = 952 Score = 27.9 bits (59), Expect = 3.6 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 94 VGPAIIDEFEP-ISVGPAIVNEFEPISVRPAIVDEFVPISVG 216 +G IDE+ I PA+ F+P+ V V+E + I G Sbjct: 427 IGATTIDEYRKHIEKDPALERRFQPVKVPEPTVEEAIQILQG 468 >At2g43010.2 68415.m05338 phytochrome-interacting factor 4 (PIF4) / basic helix-loop-helix protein 9 (bHLH9) / short under red-light 2 (SRL2) identical to SP|Q8W2F3 Phytochrome-interacting factor 4 (Basic helix-loop-helix protein 9) (bHLH9) (Short under red-light 2) {Arabidopsis thaliana}; supporting cDNA gi|18026965|gb|AF251694.1|AF251694 Length = 428 Score = 27.9 bits (59), Expect = 3.6 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 Query: 200 TNSSTMAGLTEIGSNSLTMAGPTEMGSNSS 111 TNSS+ TE+ S+T GP+ GSN S Sbjct: 142 TNSSSGIRETEMEQYSVTTVGPSHCGSNPS 171 >At2g43010.1 68415.m05337 phytochrome-interacting factor 4 (PIF4) / basic helix-loop-helix protein 9 (bHLH9) / short under red-light 2 (SRL2) identical to SP|Q8W2F3 Phytochrome-interacting factor 4 (Basic helix-loop-helix protein 9) (bHLH9) (Short under red-light 2) {Arabidopsis thaliana}; supporting cDNA gi|18026965|gb|AF251694.1|AF251694 Length = 430 Score = 27.9 bits (59), Expect = 3.6 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 Query: 200 TNSSTMAGLTEIGSNSLTMAGPTEMGSNSS 111 TNSS+ TE+ S+T GP+ GSN S Sbjct: 142 TNSSSGIRETEMEQYSVTTVGPSHCGSNPS 171 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 27.9 bits (59), Expect = 3.6 Identities = 21/83 (25%), Positives = 32/83 (38%), Gaps = 4/83 (4%) Frame = +1 Query: 22 PTKGLVSPGVAAPAPIIDDFVPIAVGPAIIDEFEPISVGPAIVNEFEPISVRPAIVDEFV 201 P P V+AP P+ P+ P + P+S P P + P + Sbjct: 39 PPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPP---ASPPPATPPPVASPPP 95 Query: 202 PIS----VGPAIVDNPPLAPVAT 258 P++ P V PP AP+A+ Sbjct: 96 PVASPPPATPPPVATPPPAPLAS 118 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 27.9 bits (59), Expect = 3.6 Identities = 21/83 (25%), Positives = 32/83 (38%), Gaps = 4/83 (4%) Frame = +1 Query: 22 PTKGLVSPGVAAPAPIIDDFVPIAVGPAIIDEFEPISVGPAIVNEFEPISVRPAIVDEFV 201 P P V+AP P+ P+ P + P+S P P + P + Sbjct: 39 PPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPP---ASPPPATPPPVASPPP 95 Query: 202 PIS----VGPAIVDNPPLAPVAT 258 P++ P V PP AP+A+ Sbjct: 96 PVASPPPATPPPVATPPPAPLAS 118 >At3g52120.1 68416.m05721 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / D111/G-patch domain-containing protein contains Pfam profiles PF01585: G-patch domain, PF01805: Surp module Length = 443 Score = 27.5 bits (58), Expect = 4.8 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -2 Query: 128 MGSNSSMMAGPTAIG-TKSSMMGAGAATPGLTRP 30 +GS+ MA P G K++ +G GA+ PG +P Sbjct: 379 IGSSRKGMADPIMAGDVKTNNLGVGASAPGEVKP 412 >At5g14690.1 68418.m01721 expressed protein predicted protein, Arabidopsis thaliana Length = 217 Score = 27.1 bits (57), Expect = 6.3 Identities = 12/47 (25%), Positives = 21/47 (44%) Frame = -1 Query: 141 RSD*NGLELIYDGRSDSDRYKVVDDGSRCGNAGTHQALSRAGDSNGH 1 R + NG + Y + R++ ++G +CG G GD + H Sbjct: 108 RGNINGEDEFYHHNNHHRRFETAEEGEKCGCGGGGGGCYGGGDYDDH 154 >At2g25980.1 68415.m03120 jacalin lectin family protein similar to myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin domain Length = 449 Score = 27.1 bits (57), Expect = 6.3 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -1 Query: 219 GSNGDRYELVDDGRPNGDRFEFVDNGRSD*NGLELIYD 106 GS GD E DDG +G R +V G + ++ +YD Sbjct: 308 GSGGDGGESWDDGAFDGVRKIYVGQGENGIASVKFVYD 345 >At5g16780.1 68418.m01965 SART-1 family protein contains Pfam domain, PF03343: SART-1 family Length = 820 Score = 26.6 bits (56), Expect = 8.4 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 4/58 (6%) Frame = -2 Query: 365 NDNHGLWDNGIDTGSGDNRGRASLVDVQNDL----HERSAVATGARGGLSTIAGPTEI 204 +DN GL + G + + + AS +D+QN + ER A A LS +A +I Sbjct: 152 SDNRGLNEGGDNVDAASSGKEASALDLQNRILKMREERKKKAEDASDALSWVARSRKI 209 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 26.6 bits (56), Expect = 8.4 Identities = 23/71 (32%), Positives = 28/71 (39%), Gaps = 4/71 (5%) Frame = +1 Query: 40 SPGVAAPAPIIDDFVPIAVGPAIIDEFEPIS-VGPAIVNEFEPISVRPAIVDEFVPISVG 216 SPG + P+P I PI V P S P+ PI P PIS G Sbjct: 515 SPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPG 574 Query: 217 ---PAIVDNPP 240 P I+ +PP Sbjct: 575 QNSPPIIPSPP 585 >At2g01760.1 68415.m00106 two-component responsive regulator family protein / response regulator family protein similar to response regulator 9 (GI:14189890) [Zea mays]; similar to ARR1 protein (GI:4210449) [Arabidopsis thaliana]; contains Pfam profile: PF00072 response regulator receiver domain Length = 382 Score = 26.6 bits (56), Expect = 8.4 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = -2 Query: 407 IDNNHGLSYDFGFVNDNHGLWDN---GIDTGSGDNR 309 IDN+H S+ NDN G N +D S NR Sbjct: 299 IDNHHSASFGVWIPNDNLGRSQNEHFSVDVSSASNR 334 >At1g70740.1 68414.m08154 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 425 Score = 26.6 bits (56), Expect = 8.4 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = -2 Query: 221 AGPTEIGTNSSTMAGLTEIGSNSLTMAGPTEMGSNSSMMAGPTAIGTKSS 72 +G +GT S+T + GSN T G G+ +S A + T+S+ Sbjct: 360 SGAASLGTLSTTGSSTDSFGSNLNTNTGTGVRGTPASSKASTRSNATRSA 409 >At1g47320.1 68414.m05239 expressed protein similar to putative non-LTR retroelement reverse transcriptase GB:AAD21515 GI:4510429 from [Arabidopsis thaliana]; expression supported by MPSS Length = 259 Score = 26.6 bits (56), Expect = 8.4 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = -2 Query: 416 DGSIDNNHGLSYDFGFVNDNHGLWDNGIDTGSG 318 DG+ N GL+ G + DN G W G G Sbjct: 106 DGASRGNPGLATAGGVLQDNEGRWCGGFSLNIG 138 >At1g27950.1 68414.m03424 lipid transfer protein-related low similarity to lipid transfer protein Picea abies GI:2627141; contains Pfam profile: PF00234: Protease inhibitor/seed storage/LTP family Length = 193 Score = 26.6 bits (56), Expect = 8.4 Identities = 16/70 (22%), Positives = 29/70 (41%) Frame = -2 Query: 275 LHERSAVATGARGGLSTIAGPTEIGTNSSTMAGLTEIGSNSLTMAGPTEMGSNSSMMAGP 96 LH S G+S + + TN++T + G + T A T+ G ++S G Sbjct: 108 LHNASITNCPKLLGISPSSPDAAVFTNNATTTPVAPAGKSPATPATSTDKGGSASAKDGH 167 Query: 95 TAIGTKSSMM 66 + ++M Sbjct: 168 AVVALAVALM 177 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,345,664 Number of Sequences: 28952 Number of extensions: 175782 Number of successful extensions: 771 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 724 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 760 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 791932800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -