BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0513 (593 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5032| Best HMM Match : COX1 (HMM E-Value=8.3e-10) 101 3e-22 SB_20687| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_57614| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.019 SB_5733| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.019 SB_50221| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.019 SB_39830| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.019 SB_15102| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.019 SB_3498| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.019 SB_13289| Best HMM Match : DUF543 (HMM E-Value=10) 28 6.5 SB_43698| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 >SB_5032| Best HMM Match : COX1 (HMM E-Value=8.3e-10) Length = 229 Score = 101 bits (243), Expect = 3e-22 Identities = 46/67 (68%), Positives = 56/67 (83%) Frame = +1 Query: 1 TGIKIFR*LATIHGTQINYNPNIL*RLGFVFLFTVGGLTGVILANSSIDITLHDTYYVVA 180 TGIK+F LAT++G I + +L +GFVFLFT+GGLTGVILANSS+D+ +HDTYYVVA Sbjct: 20 TGIKVFSWLATLYGGAIRLDTPMLWAIGFVFLFTIGGLTGVILANSSLDVVMHDTYYVVA 79 Query: 181 HFHYVLS 201 HFHYVLS Sbjct: 80 HFHYVLS 86 Score = 72.9 bits (171), Expect = 2e-13 Identities = 34/54 (62%), Positives = 37/54 (68%) Frame = +3 Query: 228 GIY*LISFITGLSLNSYILKIQFFTIFIGVNITFFPQHFLGLAGIPRRYSDYPD 389 G Y ITG N KI F+ +FIGVNITFFPQHFLGLAG PRRYSD+ D Sbjct: 96 GFYFWFGKITGYCYNELYGKIHFWIMFIGVNITFFPQHFLGLAGFPRRYSDFAD 149 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 524 SIE*YQNLPPAEHSYNELPIL 586 S+E Q PPA H+YNELP + Sbjct: 199 SLEWVQQSPPALHTYNELPFV 219 >SB_20687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 72.9 bits (171), Expect = 2e-13 Identities = 34/54 (62%), Positives = 37/54 (68%) Frame = +3 Query: 228 GIY*LISFITGLSLNSYILKIQFFTIFIGVNITFFPQHFLGLAGIPRRYSDYPD 389 G Y ITG N KI F+ +FIGVNITFFPQHFLGLAG PRRYSD+ D Sbjct: 10 GFYFWFGKITGYCYNELYGKIHFWIMFIGVNITFFPQHFLGLAGFPRRYSDFAD 63 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 524 SIE*YQNLPPAEHSYNELPIL 586 S+E Q PPA H+YNELP + Sbjct: 113 SLEWVQQSPPALHTYNELPFV 133 >SB_57614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 36.3 bits (80), Expect = 0.019 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 339 HFLGLAGIPRRYSDYPD 389 HFLGLAG PRRYSD+ D Sbjct: 1 HFLGLAGFPRRYSDFAD 17 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 524 SIE*YQNLPPAEHSYNELPIL 586 S+E Q PPA H+YNELP + Sbjct: 67 SLEWVQQSPPALHTYNELPFV 87 >SB_5733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 36.3 bits (80), Expect = 0.019 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 339 HFLGLAGIPRRYSDYPD 389 HFLGLAG PRRYSD+ D Sbjct: 1 HFLGLAGFPRRYSDFAD 17 >SB_50221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 36.3 bits (80), Expect = 0.019 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 339 HFLGLAGIPRRYSDYPD 389 HFLGLAG PRRYSD+ D Sbjct: 1 HFLGLAGFPRRYSDFAD 17 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 524 SIE*YQNLPPAEHSYNELPIL 586 S+E Q PPA H+YNELP + Sbjct: 67 SLEWVQQSPPALHTYNELPFV 87 >SB_39830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 36.3 bits (80), Expect = 0.019 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 339 HFLGLAGIPRRYSDYPD 389 HFLGLAG PRRYSD+ D Sbjct: 1 HFLGLAGFPRRYSDFAD 17 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 524 SIE*YQNLPPAEHSYNELPIL 586 S+E Q PPA H+YNELP + Sbjct: 67 SLEWVQQSPPALHTYNELPFV 87 >SB_15102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 36.3 bits (80), Expect = 0.019 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 339 HFLGLAGIPRRYSDYPD 389 HFLGLAG PRRYSD+ D Sbjct: 1 HFLGLAGFPRRYSDFAD 17 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 524 SIE*YQNLPPAEHSYNELPIL 586 S+E Q PPA H+YNELP + Sbjct: 67 SLEWVQQSPPALHTYNELPFV 87 >SB_3498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 36.3 bits (80), Expect = 0.019 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 339 HFLGLAGIPRRYSDYPD 389 HFLGLAG PRRYSD+ D Sbjct: 1 HFLGLAGFPRRYSDFAD 17 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 524 SIE*YQNLPPAEHSYNELPIL 586 S+E Q PPA H+YNELP + Sbjct: 67 SLEWVQQSPPALHTYNELPFV 87 >SB_13289| Best HMM Match : DUF543 (HMM E-Value=10) Length = 319 Score = 27.9 bits (59), Expect = 6.5 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 513 ISHHQLNDIKIYHQQNIHIMNYQF 584 I+HHQ + I I H Q+ I+NY + Sbjct: 296 INHHQSSSIIINHHQSSSIINYYY 319 >SB_43698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 27.5 bits (58), Expect = 8.6 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +3 Query: 318 NITFFPQHFLGLAGIPRRY 374 +I F +H+L + G+PRRY Sbjct: 174 SIRFLVEHYLDIQGVPRRY 192 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,862,943 Number of Sequences: 59808 Number of extensions: 169386 Number of successful extensions: 308 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 275 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 308 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -