BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= mg--0511 (784 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 27 0.87 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 24 4.6 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 26.6 bits (56), Expect = 0.87 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +3 Query: 465 KMPINTNSTTIILGNTFYIPVTLNDFLRLKT 557 K+P ++ I++G ++ TL+ FLRL T Sbjct: 338 KIPPGAEASNILVGEVDFLDKTLSAFLRLNT 368 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 24.2 bits (50), Expect = 4.6 Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 3/32 (9%) Frame = +2 Query: 347 KRGLLPKNNLGIPD---IFRLSICILQTRTSL 433 K+G+LPK+ +PD + R+ CI+ S+ Sbjct: 443 KQGILPKHASNLPDVSFVHRVQTCIIPAAFSV 474 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 765,468 Number of Sequences: 2352 Number of extensions: 15072 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81913191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -