Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= mg--0511
         (784 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g61190.1 68414.m06895 disease resistance protein (CC-NBS-LRR ...    28   6.1  

>At1g61190.1 68414.m06895 disease resistance protein (CC-NBS-LRR
            class), putative domain signature CC-NBS-LRR exists,
            suggestive of a disease resistance protein.
          Length = 967

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 18/62 (29%), Positives = 26/62 (41%), Gaps = 1/62 (1%)
 Frame = +1

Query: 4    FFHKLIVYL*TVYHICVMYNIHDI*AIVCLVHENYEIYIKKVIP-THT*RFNWPFYYASY 180
            FF    +YL  V+  C++    D   + C+VH +Y  +   V P T    F   FY    
Sbjct: 905  FFFYCFIYLLVVHLDCIIDLHSDTSGMCCVVHLDYVFHFPFVFPKTFCILFRLHFYTIKS 964

Query: 181  CC 186
             C
Sbjct: 965  LC 966


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,125,599
Number of Sequences: 28952
Number of extensions: 295586
Number of successful extensions: 536
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 526
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 536
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1755792000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)